KEGG   Coxiella burnetii CbuK_Q154: CbuK_0175Help
Entry
CbuK_0175         CDS       T00788                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00270  Cysteine and methionine metabolism
cbc00480  Glutathione metabolism
cbc01100  Metabolic pathways
Module
cbc_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:cbc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CbuK_0175 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CbuK_0175 (gshB)
Enzymes [BR:cbc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     CbuK_0175 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ACJ19492
Position
160541..161506
Genome map
AA seq 321 aa AA seqDB search
MNLKVGVLMDPIANIAIHKDTTFAMLLALQARQHEVYYLEPADIFLRNEKILGSMRRLQV
ADDPSQWFNLSESEIKPLHALDVLLMRKDPPFNMSYVYLTYLLELAEKQGLFVVNKPASL
RDANEKLFTGWFPHCTPKTLVTSRKAILQEFIREQKEVVIKPLGAMAGESIFYLTVNDPN
IPVVIETMTANGHQLVMAQRFIPEVKSGDKRIILIDGEPIPYTLARIPPKGDFRGNLARG
AKGEGRELTDRDRWICEQVGPTLRKKGLWFVGLDIIGDYLTEINVTSPTGVRELQAQFDV
DIAGQFIAFLETKYATTTDIE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagtcggggttttgatggaccccattgcaaatatcgccattcataaggac
accacttttgccatgctgttggcgctgcaagcgcggcaacacgaggtttattacttagaa
cccgccgatatttttctgcgaaatgagaaaattctaggttcaatgcgacgtcttcaagtg
gcagatgacccttcccagtggtttaatcttagcgaaagcgagattaaaccactccacgcg
ctggacgtgctactcatgcgaaaagatccgccctttaatatgtcttacgtttatttaact
tatttacttgaattggctgaaaaacaaggtttgttcgtggtgaataaacccgcgagctta
cgagatgccaatgaaaaattatttacgggatggttcccgcactgcacgccaaaaacgctg
gtcacttcgcgaaaagcgatattacaggaatttattcgtgaacagaaagaagttgtcatt
aaacccttaggcgcgatggcgggggaatcgattttttatttaactgtgaatgatcccaac
attccggtcgttattgaaacgatgacggcgaatggtcaccaattagtcatggcgcaacga
tttattcccgaagtcaaatccggtgataaacggattattttaattgatggcgagccgatt
ccttacacgcttgcacgcatcccgcctaagggcgactttcgcggtaatttagcgcgcggc
gcaaaaggcgaagggcgcgaactgacggatcgcgaccgctggatttgcgagcaagtgggt
ccaacgctgcggaaaaaaggtctctggtttgtcggactggatatcatcggcgattattta
accgaaattaatgttacgagtccaacaggtgttcgcgagttgcaggcacaatttgatgtt
gacatcgcaggtcagttcatcgctttcctggaaaccaaatacgccacaactaccgacatt
gaatag

DBGET integrated database retrieval system