KEGG   Coxiella burnetii CbuK_Q154: CbuK_1022Help
Entry
CbuK_1022         CDS       T00788                                 

Gene name
trpBF
Definition
(GenBank) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00260  Glycine, serine and threonine metabolism
cbc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbc01100  Metabolic pathways
cbc01110  Biosynthesis of secondary metabolites
cbc01130  Biosynthesis of antibiotics
cbc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CbuK_1022 (trpBF)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CbuK_1022 (trpBF)
Enzymes [BR:cbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CbuK_1022 (trpBF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CbuK_1022 (trpBF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PRAI
Motif
Other DBs
NCBI-ProteinID: ACJ20230
Position
973258..975072
Genome map
AA seq 604 aa AA seqDB search
MIEQPLIKICGIKDSALASKAVQMGADFIGIITYSKSKRYVNNKMAQNLAKAIRKAGGRP
VAVFVDFSAKAMESFCKSTGIDVVQLHGAISKAEHHLLPASLQRIYVLSVNKNGSILKDD
AGGLEHLDEKRDFLLFDNEIGGSGQSYDLNQFNYTGKFRYFLSGGLSPTNVNRAIQLTKP
QGVDVSSGVEDSNGNKKLTLIQSFITNVRKNPAGRFGTFGGCYVAETLMAPLQELQESMT
RIVKSNVFQTTFHDILQHYAGRPTPLTEAKRLSDFIQGPRIFLKREDLLHTGAHKINNAL
GQCLLAKKLKKTRIIAETGAGQHGVASATACAYFDLRCDIYMGAEDMKRQAPNVERMKLS
GANVIPVLAGSQTLKDAVNEALRDWSASYENTHYCLGSALGPHPFPEMVALFQSVIGKEA
KTQVHEQTGKQPDAIIACVGGGSNAIGIFSAFIDDPTVRLIGVEAGGKGNQLGEHAARIK
HQRKGVLHGTYTYLLQDENGQIAKTHSISAGLDYPAIGPQHAFLFETGRAIYTSVSDKDA
LTAFKLLAKTEGIIPALESSHAIAYLLKEGRKEGRKKFSRKDIVIVNLSGRGDKDIPALK
EYSL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagcccttgattaaaatctgcggtataaaagattcggcactggcaagcaaa
gccgttcaaatgggagcggattttattggtatcattacctattcaaaatcaaaacgttat
gtaaataataaaatggctcaaaatcttgcaaaagctattaggaaagcaggcggcagaccc
gttgctgttttcgttgatttttcagcaaaagccatggaatctttttgtaagtccacggga
atcgatgtcgtgcagttacatggcgctatttcaaaagccgaacatcatctattgccagca
tcattgcaacgcatttatgttctctccgttaataaaaacgggtcgattttaaaagacgac
gccggagggcttgagcatctagatgaaaaaagggattttcttttatttgataatgaaatt
ggcggaagtggccaatcctacgacctgaatcaatttaattatactggaaaattccgttac
tttttatcgggcggtctgtctcctacgaatgtaaatcgcgcaattcaattaacaaaacca
cagggcgtagacgtttccagtggtgttgaagatagtaacggcaataagaagttaacgctt
atccaatcttttattaccaatgtccgaaaaaatccggcagggcgctttggcacttttggc
ggttgctatgtcgctgaaactttaatggctcccctacaagaattacaagaatccatgacg
cgcattgtaaaatcaaacgtctttcaaaccacttttcacgatattttacaacattacgcg
ggtcgtccaacgccattaacggaagcaaaacgattgagtgattttattcaaggtccgcgt
atttttttaaagcgcgaagatttattacataccggcgcacacaaaataaataatgccttg
ggacaatgtttgctggctaaaaaactgaaaaagactcgcatcatcgctgaaaccggcgcg
ggacagcacggggtggcgagtgcaactgcctgtgcttattttgatttgcgttgcgatatt
tatatgggcgccgaggatatgaaacgccaagcgcctaatgtagagcgaatgaagttatca
ggcgccaacgtgattcccgttttagctggatcacaaacattaaaagacgctgtcaacgaa
gcattacgtgattggtccgccagttatgaaaatacccactattgtttagggtcagcgcta
ggtccgcatccttttcctgaaatggtggctctttttcagtctgttattggtaaagaagcc
aaaactcaagttcatgaacaaacgggaaaacaacctgatgctattatcgcctgcgttggt
ggcggttcaaatgcgattggtattttttcagcgtttattgacgatccaaccgtaaggtta
attggcgttgaagcgggtggtaaaggcaaccaactgggcgagcatgccgcgcggattaaa
caccaacgcaaaggcgttctgcatggcacttatacttatcttttacaagatgagaatggc
caaattgcgaagacgcactctatttcggctggcttggattacccagcgatcgggccacaa
catgctttcctttttgaaacgggtcgggccatttataccagcgtcagcgataaagacgca
ttaaccgcatttaaattattagcaaaaacggagggcattattccagcgctggagtcatct
cacgcgatagcttatttattaaaggaaggaaggaaggaaggaaggaaaaaattttcgcga
aaagacattgtcatcgtcaatttatcagggcgcggcgacaaagatattcctgcactcaag
gagtatagtttataa

DBGET integrated database retrieval system