KEGG   Coxiella burnetii CbuK_Q154: CbuK_1064Help
Entry
CbuK_1064         CDS       T00788                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00020  Citrate cycle (TCA cycle)
cbc00480  Glutathione metabolism
cbc01100  Metabolic pathways
cbc01110  Biosynthesis of secondary metabolites
cbc01120  Microbial metabolism in diverse environments
cbc01130  Biosynthesis of antibiotics
cbc01200  Carbon metabolism
cbc01210  2-Oxocarboxylic acid metabolism
cbc01230  Biosynthesis of amino acids
Module
cbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuK_1064 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CbuK_1064 (icd)
Enzymes [BR:cbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CbuK_1064 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACJ20267
Position
complement(1015839..1017125)
Genome map
AA seq 428 aa AA seqDB search
MMTELTGVSIVTYQHIKVPSQGEKITVNKAVLEVPDRPIIPFIEGDGIGIDITPVMKNVV
DAAVEKSYAGKRKIEWMEIYAGEKATKVYGKDNWLPDETLEAIKEYQVAIKGPLTTPVGG
GIRSLNVALRQQLDLYVCLRPVRYFTGVPSPVKTPEKVNMVIFRENSEDIYAGIEWPAGS
PEAMKLINFLQNEMGVKKIRFPETAGIGIKPVSKEGTSRLVRRAIQYAIDNDRDSVTLVH
KGNIMKFTEGAFKDWGYEVAVKEFGAKPLDGGPWHVFENPKTGQKITIKDVIADAFLQQI
LLRPAEYSVIATLNLNGDYISDALAAEVGGIGIAPGANLSDTVGLFEATHGTAPKYAGQD
KVNPGSLILSAEMMLRYLGWKEAADLVVQGIEGAIESKTVTYDFARLMTGAKEVSTSQFG
KAIIKHIL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacggagttaaccggagtatccatcgtgacttaccaacacatcaaagttcccagc
caaggtgaaaaaatcaccgttaataaagccgttttagaagttcctgaccgacccattatt
ccctttatcgaaggagatgggattggcattgatatcacgcccgtcatgaaaaacgtggtc
gatgccgccgtggaaaaatcctacgctggaaagcgaaaaattgaatggatggagatctac
gccggagaaaaggctacgaaagtgtatggcaaagacaattggctgcctgatgagacactc
gaagccattaaggaataccaagtggccattaaaggtcccttaaccacgccggtggggggt
ggcatacgttcgctcaatgtcgcgctgcgccaacagttagacctgtatgtttgccttagg
cccgtccgttattttacgggtgtgccaagcccggtcaaaacgcctgaaaaggtgaatatg
gtgattttccgcgaaaattccgaagatatttacgccggaattgaatggccggcgggaagc
ccggaagcgatgaaattaatcaacttccttcaaaacgaaatgggcgtaaagaaaatccgt
ttcccggaaacggcggggatagggattaaaccggtttctaaagaaggcacgagccgttta
gtacgccgagcgattcaatatgccattgataatgaccgcgattccgtgacgctcgtccat
aaaggtaacatcatgaaattcacggagggggcttttaaagattggggctatgaagtcgct
gtcaaagaatttggagcaaagcccttagatggcggaccctggcatgtctttgagaatccg
aaaacaggccaaaagattacgattaaagacgttattgccgacgcctttttacaacaaatt
ttattgcgtcccgccgagtacagcgtcatcgccaccttgaacctcaatggagattatatc
tccgacgcgttagcggccgaagtcggcggcattggcattgctccgggcgctaatttaagc
gacaccgtcggtctttttgaagccactcatgggacagcgcctaaatatgcggggcaagat
aaagtcaatccaggctctctaattttatcagcagaaatgatgctccgttacctaggctgg
aaagaagccgccgaccttgtcgttcaaggtattgagggggcgattgaaagcaaaacagta
acttacgattttgcccgtttgatgaccggcgccaaagaagtaagtacctctcagttcggc
aaagccataattaagcatattctgtag

DBGET integrated database retrieval system