KEGG   Coxiella burnetii CbuK_Q154: CbuK_1263Help
Entry
CbuK_1263         CDS       T00788                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00071  Fatty acid degradation
cbc00072  Synthesis and degradation of ketone bodies
cbc00280  Valine, leucine and isoleucine degradation
cbc00310  Lysine degradation
cbc00362  Benzoate degradation
cbc00380  Tryptophan metabolism
cbc00620  Pyruvate metabolism
cbc00630  Glyoxylate and dicarboxylate metabolism
cbc00640  Propanoate metabolism
cbc00650  Butanoate metabolism
cbc00900  Terpenoid backbone biosynthesis
cbc01100  Metabolic pathways
cbc01110  Biosynthesis of secondary metabolites
cbc01120  Microbial metabolism in diverse environments
cbc01130  Biosynthesis of antibiotics
cbc01200  Carbon metabolism
cbc01212  Fatty acid metabolism
cbc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CbuK_1263
   00630 Glyoxylate and dicarboxylate metabolism
    CbuK_1263
   00640 Propanoate metabolism
    CbuK_1263
   00650 Butanoate metabolism
    CbuK_1263
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CbuK_1263
   00072 Synthesis and degradation of ketone bodies
    CbuK_1263
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CbuK_1263
   00310 Lysine degradation
    CbuK_1263
   00380 Tryptophan metabolism
    CbuK_1263
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CbuK_1263
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CbuK_1263
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CbuK_1263
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbc04147]
    CbuK_1263
Enzymes [BR:cbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CbuK_1263
Exosome [BR:cbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CbuK_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACJ20447
Position
complement(1218722..1220017)
Genome map
AA seq 431 aa AA seqDB search
MAKPIYIVDGARTPFIKARGNPGPFSASDLAVAAGRALLNRQPFDRTDFDEVIMGCIMPS
ENEANIGRLIALRLGCGKDMPGWTVQRNCGSGMQAIDSAMKDIALGRADLVLAGGTEAMS
RAPLILNEKMVNWLADWQQAKSFRDKFTVMSRLRPHYFKPNIALLRGLTDPVCELIMGQT
AEVLAHQFNITREAMDAYALRSHQRLAAAQENGYLKEIVPLFTDEGKFYDRDDGVRPDTS
LKKLAQLKPIFDRKFGEVTAGNSSQVTDGASLVIVASEKAVKKYRLPVLGRIVDVEWAAL
APEVMGLGPVFAATSLLQRNRLTLEDIDYWEMNEAFAATILACQKAWASEEFCKKYLGLE
KAVGQLDEEKLNIDGGAIAIGHPVGTSGARIVLHLLEILKRKKAKRGIAALCIGGGQGGA
MLLEREAGGKD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccaatctacatcgtcgacggagcgcgtacgccttttatcaaagcgcgcgga
aaccccggtcctttttcagcgtctgatttagccgtcgctgcggggcgcgcgttattaaat
cgccagccgtttgatcggactgattttgacgaagtcattatgggctgcatcatgccgagc
gaaaacgaggccaatatcgggcggttaattgcattgcgtttaggctgtggaaaagatatg
cccggctggaccgtgcaacgcaattgcggttcaggaatgcaggccattgattcagcgatg
aaagacatcgctttaggtcgtgcggatcttgtcttagccggtggcacagaagcaatgagc
cgtgcacccttaattttaaatgaaaaaatggtgaattggttagcggactggcaacaagcc
aaaagttttcgtgacaaattcactgtcatgagtcgtttacgcccccattatttcaaaccg
aatatcgccttattgcggggtcttacggatcctgtgtgtgaattaattatgggacaaacg
gctgaggtgcttgcgcatcaattcaatattacccgtgaagccatggacgcctatgcttta
cgcagccaccaacgtttggccgccgcgcaagaaaatggttacctgaaagaaattgttcct
ctttttactgacgagggaaaattttatgatcgggacgatggtgttcgcccagacacctct
ctcaaaaaattagcgcagttaaaacctatttttgatcgcaaatttggagaagtaaccgcg
gggaacagttctcaagtcaccgatggggcaagcttggtcattgtcgctagcgagaaagcc
gtaaaaaaatatcgactgccggtgctaggtcgaatcgttgacgttgaatgggccgcttta
gcgccagaggtgatgggtctcggtccggtttttgcggcgacttccctgttacaacgcaat
cggttaacgcttgaagatatcgattattgggagatgaatgaagcttttgcggccacgatt
ttagcttgtcaaaaagcgtgggctagcgaggaattttgtaaaaaatatttaggactggaa
aaagccgttggccaattagatgaagaaaaattaaatatcgatggcggcgccattgccatt
ggccatccggtgggaacgagcggcgcgcgaatcgtccttcatttattggaaattctaaaa
cgcaaaaaagcaaagcgcggcatcgctgcgctttgcatcggcggtggccaaggcggggcg
atgttgttggagagagaagcaggtggtaaagactaa

DBGET integrated database retrieval system