KEGG   Coxiella burnetii CbuK_Q154: CbuK_1371Help
Entry
CbuK_1371         CDS       T00788                                 

Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00564  Glycerophospholipid metabolism
cbc00565  Ether lipid metabolism
cbc00592  alpha-Linolenic acid metabolism
cbc01100  Metabolic pathways
cbc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CbuK_1371
   00565 Ether lipid metabolism
    CbuK_1371
   00590 Arachidonic acid metabolism
    CbuK_1371
   00591 Linoleic acid metabolism
    CbuK_1371
   00592 alpha-Linolenic acid metabolism
    CbuK_1371
Enzymes [BR:cbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CbuK_1371
    3.1.1.32  phospholipase A1
     CbuK_1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ACJ20548
Position
1332560..1333594
Genome map
AA seq 344 aa AA seqDB search
MGKAIRKVGLFVIGILVILPFQSGAHTHTKTTSQLKNSRNDCRHIKRYDKKTKHYYNVVV
CKHATPPPPSFEEKLQEILSNLTPAQQSLLEKRLARQRQVTKTRAGISFYEPTYILPYYY
TGRPYHSIYEGNTPENQQLDHQEFKGQMSFQFPIWYDMFGSNLSLDISYTQLSYWQFYAK
SQFFRETNYQPQLFLSDHFSPNGLAAIGINHQSNGRGGNLERSWNRLFLDFTFTGAHWMV
DVKPWILIFKAESSDLHNPDIYRYLGYGRVVFAVTFHRQVLSLMLRNTVESGFKRGAIEL
SYSFPIHGLLHGYIQFFSGYGQSLIEYNHYTNSVGVGIIISNWI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagccatcagaaaagtgggattattcgtcatcggcattttagtcatcctacct
tttcaaagcggcgcccatactcatactaaaactacttctcaactaaaaaactcgagaaac
gactgtcgccatatcaagcgatacgataaaaaaaccaagcattactacaatgttgttgtt
tgcaaacacgccactcctccaccaccttcttttgaggaaaaattacaggaaatcttaagc
aacctgacgcccgctcaacaatccctcctcgagaagcgattggcacggcaacgacaagtt
acaaaaacacgcgcaggaatttctttttacgaaccgacgtatattttgccttattattat
accggtcgaccttatcactctatctatgaaggaaatactcctgaaaatcaacaattggat
catcaagaattcaaaggtcaaatgagcttccaatttccgatatggtatgacatgttcggt
agtaatctttcgttggatatatcctacactcagctctcttactggcaattttatgctaaa
tcccaattttttcgtgaaaccaattatcagccgcaattatttttaagcgatcatttttct
ccaaacggattagccgctattggcattaatcaccaatctaacggccgcggcggtaacttg
gaaagaagctggaatcgactttttctcgattttactttcaccggcgcccattggatggtt
gacgtcaaaccctggattttaatctttaaagcggaatccagcgatcttcacaatcccgat
atttatcgctacctcggctacggacgggttgttttcgcagtcacttttcatcggcaagtt
ctctctttaatgctgagaaatactgtcgaaagtggcttcaaacgcggcgctattgaactt
tcctattccttccccatccacggcctgttacatggctatattcaatttttcagtggttat
ggccaaagcttgattgaatacaatcattatacaaatagcgttggcgtgggaattattatc
agcaattggatttag

DBGET integrated database retrieval system