KEGG   Coxiella burnetii CbuK_Q154: CbuK_1397Help
Entry
CbuK_1397         CDS       T00788                                 

Gene name
pdhC.1
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00010  Glycolysis / Gluconeogenesis
cbc00020  Citrate cycle (TCA cycle)
cbc00620  Pyruvate metabolism
cbc01100  Metabolic pathways
cbc01110  Biosynthesis of secondary metabolites
cbc01120  Microbial metabolism in diverse environments
cbc01130  Biosynthesis of antibiotics
cbc01200  Carbon metabolism
Module
cbc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuK_1397 (pdhC.1)
   00020 Citrate cycle (TCA cycle)
    CbuK_1397 (pdhC.1)
   00620 Pyruvate metabolism
    CbuK_1397 (pdhC.1)
Enzymes [BR:cbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CbuK_1397 (pdhC.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C GCV_H HlyD_D23 RR_TM4-6 Vfa1
Motif
Other DBs
NCBI-ProteinID: ACJ20571
Position
complement(1355833..1357143)
Genome map
AA seq 436 aa AA seqDB search
MANRIEQITVPDLGGVSEVDVIEVLVKPGDTVAKEDGLITLEGDKASMDVPSPLVGTIKE
LQVKVGDKVKEGDKILTLEMSAEEEKPAKEEKKESEKSEKLEEEGKKEKEEKSEPKEEKK
KATEIKEYEAEEVEGFGTSVHAGPAVRRIAREFGIDLTKIKGTGQKDRILKEDVQKFVKE
QLKVAEGKSGIGFPPAPKIDFKKFGAIEEKPLSKIKKATGVNLSRNWMTIPHVTQFGEAD
ITELQAFRQSQKEYAAKQNVRLTPLVFIIKAVVNALKEFPHFNASLDPTGEHLILKKYFH
IGVAVDTPEGLVVPVIRDADKKGLFELAKELGEVSEKARKKGLSMNDMQGGCFSISSLGG
IGGTAFTPIINAPEVAILGVSKMQWKPICNEAGDCKTRLMLPLSLSYDHRVIDGADGARF
IVYLAERLSDIRTLLL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatcgcattgaacaaataaccgtacccgatcttggtggcgtatccgaagtggat
gtcatcgaagttttagtaaagccgggtgacaccgttgccaaagaagacggactgatcact
ttagaaggcgacaaagcctcaatggatgtgccttcgccgttggtgggtaccatcaaagag
cttcaggtaaaagtcggcgacaaagtcaaagaaggcgataaaattttaacgcttgaaatg
agcgcggaagaagaaaagcctgcaaaagaagaaaaaaaagaatctgaaaaatcggaaaaa
cttgaagaagagggaaaaaaagaaaaagaagaaaaaagtgagccaaaagaagaaaagaaa
aaggccactgaaataaaagaatacgaagccgaggaagttgagggttttggaacaagcgtt
cacgcgggccctgccgtgcgacgtattgcgcgtgaattcggtatcgatttaacaaaaatc
aaaggaactggtcaaaaagaccgaattttaaaagaagatgtgcagaagtttgtaaaagaa
cagttaaaagtagctgaaggaaaaagtggtatcggttttccgccagcgcctaaaattgat
tttaaaaaatttggcgccatcgaagaaaaacccctttcaaaaattaaaaaagcaactggc
gtaaatttaagccgtaattggatgactatcccgcatgttacccaatttggcgaagccgat
atcacagaacttcaggcattccgtcaaagtcaaaaagaatacgctgccaaacaaaacgtg
cgattaactcctttagtttttatcattaaggctgtcgttaatgcacttaaagaattcccc
cattttaatgcttcattggaccccacgggcgagcatttaattttaaaaaaatattttcat
atcggcgtagcggttgacacaccagaaggtttggtagtccctgttattcgcgatgcggac
aaaaaaggattatttgagttggctaaagaattgggtgaggttagtgaaaaagcgcgaaaa
aaagggttaagtatgaatgacatgcaaggcggctgttttagcatatcaagcttaggcgga
attggaggtacagcgtttacgccgatcattaatgcgccggaagtggcgattttgggtgtt
tctaaaatgcagtggaagccgatttgtaatgaagccggtgattgtaaaacgcgactgatg
ttacccttgagtctttcctacgatcaccgagtgatcgatggcgccgatggcgcgcggttt
atcgtttatttagccgaacggttatcggatatcagaaccttattactgtaa

DBGET integrated database retrieval system