KEGG   Coxiella burnetii CbuK_Q154: CbuK_1469Help
Entry
CbuK_1469         CDS       T00788                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00020  Citrate cycle (TCA cycle)
cbc00640  Propanoate metabolism
cbc01100  Metabolic pathways
cbc01110  Biosynthesis of secondary metabolites
cbc01120  Microbial metabolism in diverse environments
cbc01130  Biosynthesis of antibiotics
cbc01200  Carbon metabolism
Module
cbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuK_1469 (sucC)
   00640 Propanoate metabolism
    CbuK_1469 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CbuK_1469 (sucC)
Enzymes [BR:cbc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CbuK_1469 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACJ20636
UniProt: B6J8N7
Position
complement(1420649..1421821)
Genome map
AA seq 390 aa AA seqDB search
MNLHEYQSKHLLKKYNIPVPASEVVFNPDAAVDAAAKIGGDRWVVKAQVHAGGRGKAGGV
RLVKNKEELKSAVKALLGTRLVTYQTDERGQPVNQILVEQTSDIARELYLGAVIDRASQR
IVFMASTEGGVEIEKVAEKSPEKILKVTVDPAIGLQPFQCRQLFFGLGLQDLKQMRSFTD
IVMGLYRLFTERDLSLLEINPLVITGSGELICLDAKINIDDSALYRQSELREMRDTTQED
EHETMAQQWELNYIKLDGNIGCMVNGAGLAMATMDLIKLSGGDPANFLDVGGSATKERVT
EAFKIIASDKNVKGILVNIFGGIVRCDLIADGIISAVKEVGIDVPVVVRLEGNNAQLGAK
KLADSGMNIIAAKGFADAAEQIVKQVGVIA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgaatatcaatcaaaacatttattaaaaaaatacaacatccccgttcct
gccagcgaagtggttttcaatcccgacgccgctgtcgatgcggccgctaaaatcggtggc
gatcgttgggttgtcaaagcccaagtgcatgccggaggtcgtggtaaagcgggtggtgtg
cgtttggtgaagaataaagaagaattaaaatcggccgtcaaggcattattaggcacgcgg
ttagtcacctatcaaaccgatgaacgtggccagccggtgaatcagatcctcgttgaacaa
acttctgatatagcacgggaattgtacctaggggcggtgattgatcgtgcttctcaacgt
atcgttttcatggcgtcgactgaaggcggtgtggaaattgaaaaagtcgctgaaaaatcg
cctgaaaaaatactaaaagttactgttgacccggccattggtttacaaccctttcaatgt
cgccaattattttttggtttagggctccaagacttaaaacaaatgcgctcattcaccgat
attgtgatgggcttataccgattatttaccgagcgcgatttaagcttattagaaattaat
ccattggtcatcactggttcgggtgaactcatttgtttggatgccaaaatcaatatcgat
gacagcgcgctttatcgtcaatccgaattgcgcgaaatgcgagacaccactcaagaagat
gagcatgaaacgatggcccaacaatgggaattaaattacatcaaactggatggcaatatc
ggttgtatggtaaacggtgctggacttgccatggcaacgatggatttaatcaaactgtcc
ggtggcgatcctgctaatttcctcgacgttggcggcagcgctactaaagaacgcgtgaca
gaagcgtttaagattattgcatcggataaaaatgttaaaggcattttagttaatattttc
ggtggtattgttcgctgcgatctcatcgctgacggaattatcagtgcagtaaaagaagtt
ggcattgatgtgccagtggttgttcggcttgaaggaaataatgctcagttgggtgcaaaa
aaattggcagatagtggcatgaatattatcgccgccaaaggatttgccgatgcagcggaa
caaattgtcaaacaagtaggggtgatcgcataa

DBGET integrated database retrieval system