KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0041Help
Entry
CBUD_0041         CDS       T00583                                 

Gene name
pdxB
Definition
(GenBank) erythronate-4-phosphate dehydrogenase
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00750  Vitamin B6 metabolism
cbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CBUD_0041 (pdxB)
Enzymes [BR:cbd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     CBUD_0041 (pdxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DUF3410
Motif
Other DBs
NCBI-ProteinID: ABS78316
UniProt: A9KEY5
Position
41435..42562
Genome map
AA seq 375 aa AA seqDB search
MDFQLQFSIMIKILADDRIPFVSELFGDFGELILKPGAHIQNRDLLAVNALLTRSITSVD
SALLEGTAVEFVGSATAGFDHIDSTWLKKQSIHWAYAPGANATAVAEYVLHCVAYLHKKN
LLPRKSATAAIIGVGHVGCVVSDRLRKIGFTVFHNDPPRAQLEKDFISVPLASLANVDLV
CLHTPLVKTGNFPTYHLIDNRFLKMLKPGSVLLNAGRGAVIDNNALLQCDHVITCLDVWE
NESTVNLQLLEKTTIATPHIAGYSKQAKLRATLMIYDAFLKYFHLSDTRRFSELQQLQET
MTLNIQDGRNAEDILLTLFDPGRESQRMREALAENPDQFEYLRRHFPLRNEFSAIQLTPT
PSALLRKELDDWGFK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggattttcagctacagttttcgatcatgataaaaatcttagctgatgaccgcatcccc
tttgtttccgagctctttggcgacttcggtgaactgatattaaagccgggggctcacatt
caaaatcgtgatcttctcgctgttaatgcgttgctgactcggtctattacttccgtagat
tccgccttgctggaggggacggctgtcgaatttgttggcagtgcgacagcaggattcgat
catatcgattctacgtggctcaaaaaacaatctatccattgggcctatgcgcctggcgct
aatgcgacggccgtagcggaatacgtgcttcattgcgtggcttatttgcataagaaaaac
ttattgccgcgcaaatcagccacagcggcaatcattggcgttggccatgtgggttgtgtt
gtgtctgatcgattgagaaaaattggttttacggtttttcataacgaccccccgcgcgcg
cagctggaaaaggattttatttcagttcctttagcctcgctggccaacgttgatctcgtt
tgtttacacacgcctttagttaaaacgggaaactttccgacctatcatttaattgataat
cgttttcttaaaatgttaaaacctggcagcgtattactaaacgccgggcgaggggctgtt
attgataataatgctttattacagtgtgaccacgttataacttgcttagatgtttgggaa
aatgaatccactgttaatttacaattattggaaaaaacaaccattgccactcctcacatt
gccggctatagcaagcaggcgaaattgcgtgcaacgctgatgatttacgacgcttttcta
aaatattttcatttatcggatacgcgccgatttagcgagttgcagcagttgcaggaaaca
atgacgctaaatattcaggacggccgcaacgctgaagatattttattaacgttattcgat
cctggccgcgaaagccaaaggatgcgcgaggcgcttgcagagaatcccgatcaatttgaa
tacctacgccggcacttcccattgcgaaatgaattctcagcgattcaattaacccctacg
ccatcagcattgctgaggaaggagttggatgattggggatttaaataa

DBGET integrated database retrieval system