KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0553Help
Entry
CBUD_0553         CDS       T00583                                 

Gene name
nuoH
Definition
(GenBank) NADH-quinone oxidoreductase chain H
  KO
K00337  NADH-quinone oxidoreductase subunit H [EC:7.1.1.2]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00190  Oxidative phosphorylation
cbd01100  Metabolic pathways
Module
cbd_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbd00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CBUD_0553 (nuoH)
Enzymes [BR:cbd01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     CBUD_0553 (nuoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADHdh Bac_transf
Motif
Other DBs
NCBI-ProteinID: ABS76963
UniProt: A9KBL2
Position
530452..531474
Genome map
AA seq 340 aa AA seqDB search
MTDQLITLIWIIIKIVLILVPLLVAVAFITLAERKVIGYMQSRVGPNRVGFRGLAQPIAD
IFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQGWVLANVNAGLLFLFAMT
SLGVYGILVAGWASNSKYAFFGALRSAAQVVSYEIPMGFALVGVLLAAGTMNLQGIVLRQ
SGGLWHWFWLPLLPLFVTYWITAVAETNRAPFDVAEGESEIVAGFHVEYAGVTFALFFLA
EYANMVLVSAIATVIFLGGWLSPFQGIPGLESLFAWVPGIVWFVLKLSLFIFTYFWMRAT
FPRYRYDQIMRLCWKVLIPVTLVWIIILALAIEFHWTHWL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaccagctaataacattaatctggataatcatcaaaattgtccttattttggtg
cctttgctggtggcggtcgcttttattaccttagcggaacgaaaagtcatcggttacatg
caatcacgggttggtcccaatcgcgttggttttcgcgggttggcgcaaccgattgctgat
atatttaagttattgttgaaagaagtcattatcccgacagcgtcgagtcgttatctttat
cttatcgcgcccattttatccttagtacctgctttagcggcgtgggcggtgattccgttt
gcgcaagggtgggtgttagctaatgtaaatgcagggctgttatttttatttgccatgact
tcattaggggtttatggaattttggtcgcgggatgggcttctaattctaaatacgcgttc
ttcggcgctttgcgttccgcagcacaagtggtgtcctatgaaattccgatgggttttgct
ttagtgggtgtactgcttgctgccggtacgatgaacctgcaaggaatcgtgcttcgtcaa
tcaggaggtctgtggcattggttttggttgcctttgttaccgttatttgtcacttattgg
ataacggcggtagcggaaactaatcgcgctccattcgatgtggcggaaggagagtcggaa
attgtcgcgggttttcacgtggaatacgctggcgtgacgtttgcccttttctttttagcg
gaatacgccaatatggttttagtttctgctattgcaaccgtgatttttttagggggatgg
ttatcgccatttcaaggcattccagggttagagtcgctttttgcgtgggttccaggaatt
gtgtggtttgtattaaaactttcgctttttattttcacttatttttggatgcgggcgaca
ttcccgcgttatcgttacgatcaaattatgcgattgtgctggaaagtgttaattccggtc
acgctggtatggataattattttagccttggctattgagtttcattggacgcattggtta
tga

DBGET integrated database retrieval system