KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1488Help
Entry
CBUD_1488         CDS       T00583                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00071  Fatty acid degradation
cbd00072  Synthesis and degradation of ketone bodies
cbd00280  Valine, leucine and isoleucine degradation
cbd00310  Lysine degradation
cbd00362  Benzoate degradation
cbd00380  Tryptophan metabolism
cbd00620  Pyruvate metabolism
cbd00630  Glyoxylate and dicarboxylate metabolism
cbd00640  Propanoate metabolism
cbd00650  Butanoate metabolism
cbd00900  Terpenoid backbone biosynthesis
cbd01100  Metabolic pathways
cbd01110  Biosynthesis of secondary metabolites
cbd01120  Microbial metabolism in diverse environments
cbd01130  Biosynthesis of antibiotics
cbd01200  Carbon metabolism
cbd01212  Fatty acid metabolism
cbd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBUD_1488
   00630 Glyoxylate and dicarboxylate metabolism
    CBUD_1488
   00640 Propanoate metabolism
    CBUD_1488
   00650 Butanoate metabolism
    CBUD_1488
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBUD_1488
   00072 Synthesis and degradation of ketone bodies
    CBUD_1488
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBUD_1488
   00310 Lysine degradation
    CBUD_1488
   00380 Tryptophan metabolism
    CBUD_1488
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBUD_1488
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBUD_1488
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBUD_1488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbd04147]
    CBUD_1488
Enzymes [BR:cbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBUD_1488
Exosome [BR:cbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBUD_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABS78392
UniProt: A9KCN6
Position
complement(1482719..1484014)
Genome map
AA seq 431 aa AA seqDB search
MAKPIYIVDGARTPFIKARGKPGPFSASDLAVAAGRALLNRQPFDRTDFDEVIMGCIMPS
ENEANIGRLIALRLGCGKDMPGWTVQRNCGSGMQAIDSAMKDIALGRADLVLAGGTEAMS
RAPLILNEKMVNWLADWQQAKSFRDKFTVMSRLRPHYFKPIIALLRGLTDPVCELIMGQT
AEVLAHQFNITREAMDAYALRSHQRLAAAQENGYLKEIVPLFTDEGKFYDRDDGVHPDTS
LKKLAQLKPIFDRKFGEVTAGNSSQVTDGASLVIVASEKAVKKYRLPVLGRIVDVEWAAL
APEVMGLGPVFAATPLLQRNRLTLEDIDYWEMNEAFAATILACQKAWASEEFCKKYLGLE
KAVGQLDEEKLNIDGGAIAIGHPVGTSGARIVLHLLEILKRKKAKRGIAALCIGGGQGGA
MLLEREAGGKD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccaatctacatcgtcgacggagcgcgtacgccttttatcaaagcgcgcgga
aagcccggtcctttttcagcgtctgatttagccgtcgctgcggggcgcgcgttattaaat
cgccagccgtttgatcggactgattttgacgaagtcattatgggctgcatcatgccgagc
gaaaacgaggccaatatcgggcggttaattgcattgcgtttaggctgtggaaaagatatg
cccggctggaccgtgcaacgcaattgcggttcaggaatgcaggccattgattcagcgatg
aaagacatcgctttaggtcgtgcggatcttgtcttagccggtggcacagaagcaatgagc
cgtgcacccttaattttaaatgaaaaaatggtgaattggttagcggactggcaacaagcc
aaaagttttcgtgacaaattcactgtcatgagtcgtttacgcccccattatttcaaaccg
attatcgccttattgcggggtcttacggatcctgtgtgtgaattaattatgggacaaacg
gctgaggtgcttgcgcatcaattcaatattacccgtgaagccatggacgcctatgcttta
cgcagccaccaacgtttggccgccgcgcaagaaaatggttacctgaaagaaattgttcct
ctttttactgacgagggaaaattttatgatcgggacgatggtgttcacccagacacctct
ctcaaaaaattagcgcagttaaaacctatttttgatcgcaaatttggagaagtaaccgcg
gggaacagttctcaagtcaccgatggggcaagcttggtcattgtcgctagcgagaaagcc
gtaaaaaaatatcgactgccggtgctaggtcgaatcgttgacgttgaatgggccgcttta
gcgccagaggtgatgggtctcggtccggtttttgcggcgactcccctgttacaacgcaat
cggttaacgcttgaagatatcgattattgggagatgaatgaagcttttgcggccacgatt
ttagcttgtcaaaaagcgtgggctagcgaggaattttgtaaaaaatatttaggactggaa
aaagccgttggccaattagatgaagaaaaattaaatatcgatggcggcgccattgccatt
ggccatccggtgggaacgagcggcgcgcgaatcgtccttcatttattggaaattctaaaa
cgcaaaaaagcaaagcgcggcatcgctgcgctttgcatcggcggtggccaaggcggggcg
atgttgttggagagagaagcaggtggtaaagactaa

DBGET integrated database retrieval system