KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1780Help
Entry
CBUD_1780         CDS       T00583                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00230  Purine metabolism
cbd01100  Metabolic pathways
Module
cbd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CBUD_1780 (gmk)
Enzymes [BR:cbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CBUD_1780 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_23 AAA_18 AAA_16 AAA_22 MobB AAA_33 Thymidylate_kin AAA_30 PRK AAA_21 ABC_tran AAA cobW MMR_HSR1 RsgA_GTPase TsaE AAA_19 IstB_IS21 NACHT CbiA
Motif
Other DBs
NCBI-ProteinID: ABS77639
UniProt: A9KGR7
Structure
PDB: 

Position
complement(1776531..1777151)
Genome map
AA seq 206 aa AA seqDB search
MNKANLFIISAPSGAGKTSLVRALVKALAEIKISISHTTRPKRPGDQEGVDYFFIDETRF
QAMVKEGAFLEHATIYERHYGTEKDWVLRQLKAGRDVLLEIDWQGARQIRELFPPALSIF
ILPPSIEALRERLIKRRQDDTAIIEQRLALAREEMAHYKEFDYLVVNDNFDQAVQNLIHI
ISAERLQRDVQEKKLSRLLAELVEKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaagccaatttatttattatttcagcgccttcaggtgctgggaaaaccagctta
gttcgtgcgcttgttaaagcattagccgagatcaaaatatccatttcgcataccacgcga
ccgaaacgcccgggcgatcaggaaggcgttgattatttttttattgatgaaactcgtttt
caggcaatggtaaaagaaggcgcttttcttgaacacgccactatttatgaacgccactat
ggaacggagaaagactgggtgctgcgtcaattaaaggctggtagggatgttttgttagaa
atcgattggcagggggcgcgccaaatccgagaattgtttcctccggcgttgtctattttc
atcttgcctccttccattgaagcgttgcgcgaacgattgattaaacgccgccaagatgac
acagcgattatcgagcagcgtttagcgttggcgcgagaggaaatggcgcattacaaggaa
tttgattaccttgtcgttaacgataattttgatcaagccgttcagaatttgattcatatt
attagcgcggaacggctgcaacgggacgttcaagaaaaaaagctatctcgcttgttggca
gaattagtggaaaagcagtaa

DBGET integrated database retrieval system