KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_2195Help
Entry
CBUD_2195         CDS       T00583                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
cbd00240  Pyrimidine metabolism
cbd00250  Alanine, aspartate and glutamate metabolism
cbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CBUD_2195 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBUD_2195 (pyrB)
Enzymes [BR:cbd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CBUD_2195 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABS76746
UniProt: A9KDE9
Position
2157786..2158718
Genome map
AA seq 310 aa AA seqDB search
MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTR
NSFEIAAKRLGAMVLNPNLKISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAK
QLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCVTIIGDIRHSRVANSLMDGLV
TMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF
RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLE
LFLLRDFRFF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacttcctttacatttattgaatatgcgctcactcacgcgcgaccatattgaa
aaactcatccaacgggcgaattattttttaactcagggcatggaaaaaaattcggtcttt
gaaacattaaaagggcacgtagtcgccaacttattttttgaacccagcacacgaacgcgc
aactcctttgaaattgcggcaaaacgtttgggcgccatggttcttaaccctaatcttaaa
atttcggcaataagtaaaggtgaaactctttttgatacgattaaaactttggaagcgatg
ggtgtttattttttcattgtacgccattctgaaaatgaaaccccggagcagatagcaaaa
caattatcctcaggcgtcgtcatcaacgcgggtgacggtaatcatcaacatccctcacaa
gctttaattgatttaatgacaataaagcaacacaaaccccattggaataaattgtgcgtc
acgattattggcgatattcgtcattctcgcgtggcaaactcattaatggacggcttagtc
acgatgggcgttccggaaattcgattggtaggcccatcgtcattattgccggacaaggtc
gggaacgactcgattaaaaaattcaccgaattaaaaccaagtctccttaacagcgacgtt
attgtcacccttcgtttgcaaaaggaacgccatgataattctgtcgatatcgatgctttt
cgcggatcttttcgattgacacctgaaaaattatattccgcaaaacccgatgccattgtt
atgcatccgggtcccgtcaaccgcgaagtcgaaattaattctgatgtcgcagataaccaa
caatctgtcatccttcaacaagtacgtaacggcgtcgctatgcggatggctgtgttggaa
ttatttttgttgcgagattttcgatttttttga

DBGET integrated database retrieval system