KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1011
Entry
Cbei_1011         CDS       T00547                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00620  Pyruvate metabolism
cbe00640  Propanoate metabolism
cbe00650  Butanoate metabolism
cbe01100  Metabolic pathways
cbe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cbei_1011
   00640 Propanoate metabolism
    Cbei_1011
   00650 Butanoate metabolism
    Cbei_1011
Enzymes [BR:cbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Cbei_1011
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABR33195
UniProt: A6LS65
Position
1212099..1214330
AA seq 743 aa
MFKQWEGFKNGTWQEDIDVRNFIQKNYKLYEGDGSFLEEKTERTSKVWGKAYALIVEEVK
KGIIDVATDRVSGIDNYDPGYIDRDNEVIVGLQTDAPLKRIVNPFGGMRMVQSSLKEYGY
ELDPEINKNFSKYRKTHNEGVFDAYTKEIRAARSAGLLTGLPDAYGRGRIIGDYRRVALY
GIDYLIEEKKKDLDNLNGDMLDELVRKREEVSMQIRALGEVKSMAAKYGIDISKPASNAK
EAAQHLYFGYLAGIKENNGAATSFGRTSTFLDIYIERDLEAGLITEKEAQEIVDQLIIKL
RLVRHLRTPEYNELFGGDPTWVTESIGGVGINGKPLVTKNSFRYLHTLINLGTSAEPNLT
VLWSDKLPESFKKYCAEISIKTDSIQYENDEVMRPVYGDDYAIACCVSAMKVGKQMQFFG
ARANIAKSLLYAINGGVDELKGIKVVPGIEKFTDEEILNFDKVKANYFKVLEYVAKVYVD
TMNIIHFMHDKYAYEASQMALHDTAVERLMAFGIAGLSVAIDSLSAIKYAKVRPIRNEEG
ITIDFEVEGDFPKYGNDDDRADDLGVELVTKFSGELKKHPLYRDAKHTLSALTITSNVMY
GKKTGTTPDGRKKGEPLAPGANPMHGRDINGALASLNSVAKIPYNEICQDGVSNTFSIVP
DALGKNEDQKITNLVAILDGYFTQGAHHLNVNVLNRQTLIDAMENPDKYPTLTIRVSGYA
VNFSRLSKEQQLEVISRTFHESI
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgtttaaacaatgggaaggattcaaaaacggaacatggcaagaggatattgatgtaaga
aactttatacaaaaaaattataaattatacgagggtgatggaagtttcttagaagagaaa
acagaaaggacaagcaaagtctggggcaaagcttatgccttaatagttgaggaagtaaaa
aagggaataattgatgttgctacagatagagtatcagggatagataattatgatcctggg
tatatagatagagataacgaagttatagttgggcttcaaacagatgcaccacttaagaga
atagtaaatccatttggtggaatgagaatggttcaaagttcattaaaggaatatggatat
gaacttgatccggaaattaataagaatttttcaaaatacagaaagactcacaacgaaggt
gtttttgatgcgtatacaaaagaaataagagcagcgagaagtgctggattattaacaggc
ctaccagatgcatacggtagaggaagaataataggtgattatagaagagtagctctttat
ggtatagattacttaatagaagaaaagaaaaaggatcttgataatctaaacggtgatatg
cttgatgagttagtaagaaaaagagaagaagtttcaatgcagattagagctttaggtgaa
gtaaaatcaatggcagcaaaatatggaattgatatatctaagccagcatcaaatgcaaaa
gaagcagcacaacatttatactttggatacttagcaggaattaaggaaaacaatggagct
gcaacatcatttggaagaacttcaaccttcttagatatatatattgaaagagatttagaa
gcaggattaattacagaaaaagaagcccaagaaattgttgaccaactaattataaagtta
agattagttagacacttaagaactccagaatataatgaattatttggtggggacccaact
tgggtaactgaatcaattggtggtgtaggtattaatggtaagccgcttgtaactaagaat
tcatttagatatcttcatactttaataaatttaggaacatcagcagaaccaaacttaaca
gttttatggtcagataagcttccagaaagctttaagaaatattgtgcagaaatctcaata
aaaacagactctattcaatatgaaaatgatgaagttatgagaccggtttatggtgatgat
tatgcaatagcttgctgcgtatcagctatgaaggttggtaaacaaatgcaattctttgga
gctagagcaaatatagctaaatcgcttttatatgctataaatggtggagtagatgagtta
aaaggtattaaggtagtaccaggaattgaaaagtttacagacgaagaaattcttaatttt
gataaagtaaaggcaaattacttcaaagtattagaatatgtagcaaaagtgtatgtggat
acaatgaacataattcactttatgcatgataaatatgcttatgaagcaagtcaaatggct
cttcatgatacagcagtagaaagattaatggcgtttggtattgcaggtctttcagtagct
atagattcattgtcagctataaaatatgcaaaagttagaccaattagaaatgaagaaggt
ataactatagattttgaagttgaaggagatttccctaaatacggaaatgatgatgacaga
gcagatgatttaggagtagaattagtaactaaattctctggagagcttaagaagcatcca
ctatacagagatgcaaaacatacattatcagcgctaacaatcacatcaaatgtaatgtat
ggtaagaaaacaggaacaacaccggatggaagaaagaaaggtgaaccattagcgccagga
gcaaacccaatgcatggaagagatattaatggagcattagcatcacttaactcagtagct
aaaataccatataatgaaatttgccaagatggtgtatctaatacattctcaatagttcca
gatgcacttggaaaaaatgaagatcaaaagataactaacctagttgcaatattagatgga
tattttactcaaggggctcatcacttaaatgttaatgttcttaatagacaaacattaata
gatgcaatggaaaatccagataagtatccaacacttacaatcagagtatcaggatatgcg
gttaactttagcagattatcaaaagaacaacagttagaagttataagcagaacattccat
gaaagtatttag

DBGET integrated database retrieval system