KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0107Help
Entry
Cbei_0107         CDS       T00547                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00471  D-Glutamine and D-glutamate metabolism
cbe00550  Peptidoglycan biosynthesis
cbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Cbei_0107
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cbei_0107
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbe01011]
    Cbei_0107
Enzymes [BR:cbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Cbei_0107
Peptidoglycan biosynthesis and degradation proteins [BR:cbe01011]
 Precursor biosynthesis
  Amino acid ligase
   Cbei_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C CbiA AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABR32297
UniProt: A6LPL7
Position
139445..140821
Genome map
AA seq 458 aa AA seqDB search
MKKDFNEFKEFIVGKKVGVVGIGVSNIPLINFLIDLGAAVTAFDKKNLEELGDVADGFNK
KGVKLELGEKYLDNLKGFDVIFKTPSMRIDSEALVRARKEGAYVTSEMEEFVRYTRGKVY
GITGSDGKTTTTTIISKLLEGQGYKTWVGGNIGTPLFSEIENIHDEDKVVLELSSFQLMT
MTQEIDVAVCTNLSPNHLDMHKSMQEYIDAKKNIFIYQNSNGLLVVNRENEITHGFIKEA
KGNVKEFSSKRELIDGAYYKNGILYLEDKEVCKKDDIVIKGMHNVENYLAAFLATKDDVS
VEVMKKVAETFAGVEHRCELVREIDGVKYYNDSIASSPTRTLAGLRAFDEKVIVIAGGYD
KNIPFEPLAYEGYPYIKELILMGATKHKIKDVFDNLENEKGIKININMVESLEEAVRLAE
SIANQGDIVTLSPACASFDMYPNFMIRGNKFKEIVKSL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggattttaatgagtttaaagaatttatagtgggtaagaaagttggagttgtt
ggaattggagtaagtaatattccgttaatcaattttttaatagatttaggtgctgctgta
acggcttttgataaaaagaatttagaagaacttggagatgttgcagatggatttaataaa
aagggagttaagctggagcttggagaaaaatatctagataacttaaaagggtttgatgtg
atatttaaaacaccatcaatgaggattgatagtgaagcattagtaagggctagaaaagaa
ggagcatatgttacttctgagatggaagagttcgttaggtatacaagaggaaaagtctat
ggaataaccggtagcgatggaaagacaacaacaacaacaattatttctaagttactagaa
ggtcaagggtataaaacatgggtcggaggaaatataggaactccattattttcagaaata
gaaaacatacatgatgaagataaagttgtattagagttatctagctttcaacttatgaca
atgactcaagaaatagatgttgcagtatgtacaaatttatccccaaatcacttagacatg
cataaaagtatgcaagagtatatagatgcgaaaaagaatatctttatatatcaaaattca
aatggacttttagtagtgaatagggagaacgaaattacccatggatttataaaagaagcg
aaaggaaatgtgaaagagttcagttcaaaaagagaactgatagatggagcatactataaa
aatgggatactctatcttgaagacaaggaagtttgcaaaaaagacgatatcgtaattaag
gggatgcataatgttgaaaattatcttgcagcatttttagcaacaaaagacgatgtctct
gtggaggtaatgaaaaaagttgctgaaacatttgctggcgttgaacataggtgtgaactt
gtaagagagatagacggagttaaatattataatgattctattgcttcaagtcctacaaga
actttagcggggcttagagcatttgatgaaaaagtaatagttattgcaggagggtatgat
aagaatataccttttgaacctttagcatatgaggggtacccatatataaaagaattgatc
cttatgggagcgacaaagcacaagatcaaagatgtttttgataatttagaaaatgaaaaa
ggaattaaaattaatataaatatggttgagtctttggaagaggcagtaagacttgctgaa
agcatagcgaatcaaggcgatattgtcactctatcacctgcttgtgcatcatttgacatg
tatcctaattttatgataagaggtaataagtttaaagagatagtgaagtctttataa

DBGET integrated database retrieval system