KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0322Help
Entry
Cbei_0322         CDS       T00547                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00071  Fatty acid degradation
cbe00280  Valine, leucine and isoleucine degradation
cbe00410  beta-Alanine metabolism
cbe00640  Propanoate metabolism
cbe00650  Butanoate metabolism
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01200  Carbon metabolism
cbe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Cbei_0322
   00650 Butanoate metabolism
    Cbei_0322
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Cbei_0322
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cbei_0322
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cbei_0322
Enzymes [BR:cbe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Cbei_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_ox_N
Motif
Other DBs
NCBI-ProteinID: ABR32510
UniProt: A6LQ80
Position
388286..389425
Genome map
AA seq 379 aa AA seqDB search
MNFQLTREQQLVQQMVREFAVNEVKPIAAEIDESERFPMENVEKMAKLKMMGIPFSKEFG
GAGGDVLSYIISVEELSKVCGTTGVILSAHTSLCASVINENGTNEQRAKYLPDLCSGKKI
GAFGLTEPGAGTDAAGQQTTAVLEGDHYVLNGSKIFITNGGVAETFIIFAMTDKSQGTKG
ISAFIVEKSFPGFSIGKLENKMGIRASSTTELVMENCIVPKENLLSKEGKGFGIAMKTLD
GGRIGIAAQALGIAEGAFEEAVNYMKERKQFGKPLSAFQGLQWYIAEMDVKIQAAKYLVY
LAATKKQAGEPYSVDAARAKLFAADVAMEVTTKAVQIFGGYGYTKEYPVERMMRDAKICE
IYEGTSEVQKMVIAGSILR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccaattaactagagaacaacaattagtacaacaaatggttagagaattcgca
gtaaatgaagttaagccaatagctgctgaaatcgacgaatcagaaagattccctatggaa
aacgttgaaaaaatggctaagcttaaaatgatgggtatcccattttctaaagaatttggt
ggagcaggcggagatgttctttcatatataatatctgtggaagaattatcaaaagtttgt
ggtactacaggagttattctttcagcgcatacatcattatgtgcatcagtaattaatgaa
aatggaactaacgaacaaagagcaaaatatttgccagatctttgtagtggtaagaaaatc
ggtgctttcggattaacagaaccaggcgctggtacagatgctgcaggacaacaaacaact
gctgtattagaaggagaccattatgtattaaatggttcaaaaatcttcataacaaatggt
ggagttgctgaaactttcataatatttgctatgacagataagagtcaaggaacaaaagga
atttctgcattcatagtagaaaagtcattcccaggattctcaataggaaaattagaaaac
aagatggggatcagagcatcttcaactactgagttagttatggaaaactgtatagtacca
aaagaaaacctacttagcaaagaaggtaagggatttggtatagcaatgaaaactcttgat
ggaggaagaattggtatagctgctcaagctttaggtattgcagaaggagcttttgaagaa
gctgttaactatatgaaagaaagaaaacaatttggtaaaccattatcagcattccaagga
ttacaatggtatatagctgaaatggatgttaaaatccaagctgctaaatacttagtatac
ctagctgcaacaaagaagcaagctggtgagccttactcagtggatgctgcaagagctaaa
ttatttgcggcagatgttgcaatggaagttacaactaaagcagttcaaatctttggtgga
tatggttacactaaggaatacccagtagaaagaatgatgagagatgctaaaatatgcgaa
atctacgaaggaacttcagaagttcaaaagatggttatcgcaggaagcattttaagatag

DBGET integrated database retrieval system