KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0662Help
Entry
Cbei_0662         CDS       T00547                                 

Definition
(GenBank) glutamate synthase (NADPH), homotetrameric
  KO
K00266  glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00250  Alanine, aspartate and glutamate metabolism
cbe00910  Nitrogen metabolism
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Cbei_0662
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cbei_0662
Enzymes [BR:cbe01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Cbei_0662
    1.4.1.14  glutamate synthase (NADH)
     Cbei_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 AlaDh_PNT_C HI0933_like FAD_binding_2 NAD_binding_7 Thi4 PrpR_N FAD_oxidored FAD_binding_3 GIDA DAO 3HCDH_N Amino_oxidase PALP 2-Hacid_dh_C XdhC_C Lycopene_cycl ApbA CitX NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ABR32849
UniProt: A6LR69
Position
792760..794154
Genome map
AA seq 464 aa AA seqDB search
MDMNERLVRIPVREQDPKVRAANFEEVCLGYNEEEATKEASRCLNCKNPKCVEGCPVSIN
IPGFISYVKDEKFEEAAKEISKYSSLPAVCGRVCPQERQCEGRCVLGIKGDSVSIGKLER
FTADWAASHNVDLSATEPKNGIKVAVIGSGPAGLTCAGDLAKKGYEVTIFEALHKAGGVL
EYGIPEFRLPKEKVVKNEVENIKKLGVKIETNVIVGRTITIDQLFEDEGFKAVFIGSGAG
LPRFMGIPGENANGVCSANEFLTRVNLMKAAVEGYDTPVRSGKKVAVVGGGNVAMDAART
ALRLGSESHIVYRRGESELPARVEEVHHAKEEGVIFDVLTNPTEILVDENGWVKGMKCVR
MELGEPDASGRRSPVEVPGSEFVMDVDTVIMSLGTSPNPLISSTTQGLEINKRRCIVAEE
ETGLTTKEAVYAGGDAVTGAATVILAMGAGKKAAKAIDEYLQEK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaatgagagattagttagaataccagtaagagagcaagatccaaaggttaga
gcagcgaactttgaagaagtttgtcttggatataacgaagaagaagcaactaaagaagct
tctagatgtttaaactgtaagaatcctaagtgtgtagaaggatgtccagtatcaatcaat
ataccaggattcatttcttatgttaaagatgaaaaatttgaagaagcagcaaaagaaatt
tcaaaatacagctcacttccagcagtttgtggaagagtatgtccacaagaaaggcaatgt
gaaggaagatgtgttttaggaataaagggtgactcagtatctattggtaaacttgaaaga
tttacagcagactgggcagcatcacataatgttgatttaagtgcaacagaacctaaaaat
ggaattaaagttgcagttataggaagtggtcctgcaggacttacttgtgctggagattta
gctaaaaaaggatatgaagtaactatatttgaggcacttcataaagcaggcggagtttta
gaatatggaattccagaattcagacttccaaaagaaaaagtagttaaaaatgaagttgaa
aacattaagaaacttggtgttaaaatagaaactaatgttatagttggcagaactataact
atagatcaattatttgaagatgaaggatttaaagctgtatttataggttcaggtgcaggg
cttccaagattcatgggaataccaggagaaaatgcaaatggagtatgctcagcaaatgaa
tttttaacaagagtaaacttaatgaaagcagcagtagaaggatacgacactccagttaga
tctggtaaaaaagttgcagtagtaggcggaggaaatgttgctatggacgcagcaagaact
gccttaagacttggatctgaaagccatatcgtttatagaagaggtgaatcagaacttcca
gcaagagtagaagaagtacatcatgctaaggaagaaggagtaatctttgacgtattaact
aatccaacagaaatcttagtagatgaaaatggatgggttaaaggaatgaaatgtgtaaga
atggaacttggagaaccagatgcatcaggaagaagaagtccagttgaagttcctggttca
gaatttgttatggatgtagacactgtaataatgtcacttggaacatcaccaaatccatta
atttcatcaacaactcaagggttagaaattaataagagaagatgtatcgtagctgaagaa
gaaacaggtcttactactaaagaagcagtttatgctggtggagatgcagttacaggagca
gcaacagtaatacttgctatgggtgctggtaagaaggcagcaaaagcaatagatgagtat
ttacaagaaaaataa

DBGET integrated database retrieval system