KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0663Help
Entry
Cbei_0663         CDS       T00547                                 

Definition
(GenBank) protein of unknown function DUF161
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABR32850
UniProt: A6LR70
Position
794524..795243
Genome map
AA seq 239 aa AA seqDB search
MNKAMNLLKRIILFFVGMSIIQFGVALFLKTNIGSDPFTVFTQGLAFALDKTGLKNVSVV
KLISGADQVTPGVANMIILIVLFAVILLVERSRIKIGTLICVVGVGPIIDLGVKVVSYFP
VESYNYFIKALLVVFGCLIIAIGFAVLSATNVGVAPNDIVPFIIQDKTKVQYRWIRITLD
AGFLIIGFILGGKVGLGTVIAMITTGPFIQFCLPYGEKFVNLLVNEKDVDVEESVTATA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcaatgaacttattaaaaagaattattttattttttgttggaatgagtata
attcagtttggtgtagcattatttttgaagactaatattggctctgatccatttactgta
tttacgcaaggtttagcgtttgcattagataaaacaggattaaagaatgtttctgtagtt
aagttgataagtggagcagatcaagtaacaccaggggtagcaaatatgattatattgatt
gtactatttgctgttatactcttagttgagagatcgcgtataaagataggaactttaatt
tgtgttgtaggagtaggaccaattatagatcttggagtgaaggttgtttcatatttccca
gttgaatcttataactattttataaaggcattattggttgtatttggatgtttaataatt
gcaatagggtttgcagttttatcagcaacaaacgtaggagttgccccaaatgatattgtt
ccatttataatacaagataagactaaggtacaataccgttggattagaataacactagat
gctggatttttaataataggatttatattaggaggaaaagttggtcttggtactgtgata
gcaatgataacaactggaccatttatacaattctgcctcccttatggagaaaagtttgta
aacttattagtaaatgaaaaagatgtagatgtagaagaaagtgttacagctactgcatag

DBGET integrated database retrieval system