KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0664Help
Entry
Cbei_0664         CDS       T00547                                 

Definition
(GenBank) alpha amylase, catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00500  Starch and sucrose metabolism
cbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cbei_0664
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Cbei_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM53 Alpha-amylase CBM_25
Motif
Other DBs
NCBI-ProteinID: ABR32851
UniProt: A6LR71
Position
complement(795406..797406)
Genome map
AA seq 666 aa AA seqDB search
MRKKIISRLIASGLFLSLNLLPISIPSFGTNGILTTAYAASSTSLPSNAKDGAILHAFDW
SFATIKNELPNIAAAGYKSVQVSPVQGTKSSSKDPSQWWLLYQPTNQSVGNAQLGNYDDF
KALCTEADKYGISIVVDVVMNHMANNGNPDQLDSSIDPSFKDPNLYHNQGQCSNWTNRYD
VTQKGIGMPDLNTQNSTVQNKAITFLNQCIDAGADGFRFDAAKHIETNIGLDSNQSWSGN
YWSNVLGNLHNKSNLFIYGEILQDGSVDNIASYESFMNVTASNYGGAVRSAVTSTNLSSL
GTTLGGVDSSKAVDFVETHDTYEDGSSKNLTDTQRKLGWAIAAARANATPLFFDRPTGNI
GSKGDDLWKDADIVAINNFHNAMVGKNEYIRWTNNNTTMLIDRGTDGTVIVNDGGSTSIN
SPTNLANGTYTNKGSANCTLTVSNGTISGNIPANSVIVLYNDGSILTPPVPSTYAPHSGY
KVDYDSSTLLQGNSFTLYYSGSLANSSSVKLHWGYNGFLNPSDVTMTKGSDGFWAATIKI
PSSATKLDFDFTNGSNWDNNSSKDWHLQVSSSSVPVQVNPAPTASKTTTIYYNGNLAANS
TSVILHWGYNDFTNPTDVTMTKQSDGRWAATITIPSATYSLNMAFKNDSGSWDSNSSANY
NYSISQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaataatatcaagattaattgcttcaggtttatttttaagtttaaactta
cttccaatttcaataccaagctttggaacaaacggaattttaactacagcttatgccgct
agtagtactagcctcccatctaatgctaaagatggagctattcttcatgcctttgactgg
tcttttgcaactataaagaatgaactaccaaacatagcggcagcaggatataaatcagtt
caggtttctcctgtacaaggaacaaaaagttcaagtaaagatccaagtcaatggtggtta
ttatatcaaccaaccaatcaatctgtaggtaatgctcaacttggaaactacgatgatttt
aaggcactttgtactgaggctgataaatatggaatttcaattgttgtagatgtagtaatg
aatcatatggctaacaatggaaatccagatcaactagattccagtatagatcctagcttc
aaagaccctaatttatatcataaccaaggacaatgtagcaattggactaatagatatgat
gtgacgcaaaaaggtataggcatgccagatttaaatactcaaaattccaccgtccaaaac
aaagcaataacatttctaaatcaatgtatagatgctggtgctgacggattccgttttgac
gcagctaaacatatcgaaactaatattggactagactctaatcaatcttggtctggaaac
tactggagtaatgttctaggtaatctgcataataaatctaatttatttatttatggcgaa
attctacaagacggttcagtagataatattgcctcttacgaatcatttatgaatgttact
gcaagtaattatggcggagcggtaagaagtgcagttacctcaacaaatttaagttcactt
ggcactaccttgggtggcgttgactcatctaaggcagtcgattttgttgaaacccatgat
acttatgaagatggatcaagcaaaaatttaacagatactcaaagaaaacttggctgggct
atagctgctgctcgtgcaaacgctacacctttattctttgacagacctactggcaatatt
ggatccaagggtgatgatctttggaaggatgctgacatagtagcaattaataacttccat
aatgcaatggtaggaaaaaatgaatatattaggtggacaaacaataatacaaccatgtta
atagatagaggaacagatggtactgtaatagtaaacgatggtggaagtacttctattaac
tctcctactaatttagcaaatggcacttatactaataaaggtagtgctaattgtacttta
acagtttcaaacggaacaatttcaggaaatattcctgctaattcggtaattgttctctac
aatgatggttcaatacttactcctcctgtaccttctacttatgctcctcattcaggttat
aaagtggattatgatagcagcactttactacaaggtaacagttttactttatactatagt
ggttctttagcaaattctagttcagttaaactccactggggatataatggcttcttaaat
ccatcagatgttacaatgactaaaggttcagatggattctgggcagcaactataaaaatt
ccttcatcagctacaaaactagatttcgattttactaacggatctaactgggataataac
tccagcaaagattggcacttacaagtttcttcatcatctgtgccagtacaagttaatcca
gcgccaacagctagtaaaacaaccactatatactacaatggaaacttagcagcaaattca
acttcagtaattttacattggggatataatgattttacaaacccaactgatgttacaatg
actaaacaatctgatggtagatgggcagcaactataactattccatctgctacttattct
ttaaatatggcatttaaaaatgattcaggatcttgggatagcaatagctcagctaactat
aactattctatatctcaataa

DBGET integrated database retrieval system