KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0668Help
Entry
Cbei_0668         CDS       T00547                                 

Definition
(GenBank) anti-sigma-factor antagonist
  KO
K04749  anti-sigma B factor antagonist
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cbe03021]
    Cbei_0668
Transcription machinery [BR:cbe03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Cbei_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAS STAS_2
Motif
Other DBs
NCBI-ProteinID: ABR32855
UniProt: A6LR75
Position
802683..802955
Genome map
AA seq 90 aa AA seqDB search
MEISIPKDFVVDEVANFRVKVNKLIDEGQKNFIFNFNDCNFIDSTGLGALVAVYKKCAEK
NGSIKLKGLKPEVEKLFKLTRLDKVFEICP
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggaaataagtataccaaaagactttgttgttgatgaagtcgcaaattttagagtaaaa
gtaaataaattaatagatgaaggacaaaagaattttatattcaattttaatgattgtaat
tttatagatagtacaggacttggcgcattagtagctgtttataaaaaatgcgctgaaaag
aatggaagtataaaattaaaaggactaaagccagaagttgagaagttatttaaattaaca
aggttagataaggtatttgaaatttgtccgtaa

DBGET integrated database retrieval system