KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0674Help
Entry
Cbei_0674         CDS       T00547                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase-like protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh CPDase
Motif
Other DBs
NCBI-ProteinID: ABR32860
UniProt: A6LR80
Position
complement(809197..810663)
Genome map
AA seq 488 aa AA seqDB search
MDGKIFYNLIGGKEMLLSGKTYKATSEFFIDYSIQCADSNIMDVKIAISKAQNAMEELQS
MSVENRKQILMKFIKLISSDEEFEKHITLMSGIPISSSRNQAQELVSFFKDQIDELFVNY
EVKNNNIYSRFDPQSIFTPKQGIVYVPLPLLAVRAIGMILPISILLGMPIIVKSNKIIVS
FLFKIADILKQLGYPAAGFNIIDFNQMNENASSLNNALINASDVVWTFGDDNSIGYEKTN
NQSTGDDVVLKDLFYGKTIINHPYHNHTAIVCNGGDIERSIDIIVESCISFPFECSLKSL
YIVEECYEEVKQKLIEKFFNLAEKTGNPLYEGNQIGFCDRDTKESVKNRIIDLEKMGLIN
ILVGVKYDQEQENVSFKNHKMNPLLLETNDELVDILTASPAVGILTIMKCTDINDGIEKI
NKVLDKKRIGVTFLGKDLKETLPEEVMLKANAIHLKVNVKTVKPDLTCHDGRFYFLLLTE
LKRILRSE
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaaaatattttacaatttaataggtggaaaggaaatgcttttaagcggaaaa
acatacaaagctaccagtgaattttttattgattattcaattcaatgtgctgattcaaat
attatggatgttaaaatagctatttcaaaagcgcaaaatgcaatggaagagttacaatca
atgtctgttgaaaataggaagcagattttgatgaagtttattaagttaatttcgtcagat
gaagaatttgaaaagcatatcactttaatgtcagggattcccataagttcttcaaggaac
caagcacaggaacttgtaagtttttttaaagatcaaatagatgaattatttgtaaattat
gaagtaaagaataataatatttattcacgctttgatccccaaagtatatttacacctaaa
caaggaatcgtttatgtaccactgcctttattggcggtgcgggcaataggcatgatattg
cctatcagtatattgcttgggatgccgattatagttaaatccaataagataatagtttct
tttctatttaagattgctgacatattaaaacaattaggatatccagcagcaggttttaat
attatcgattttaatcagatgaatgaaaatgcatcaagtcttaataatgcgttaattaac
gcaagtgatgttgtatggacattcggtgatgacaacagtataggatatgagaaaacaaat
aatcagagtacaggggatgatgtagttttgaaagatttgttttatggtaaaacaataata
aaccatccttaccataatcatacggctattgtttgcaatggtggagatatagaacgttct
atagatataattgtagagtcttgtatttcatttccgtttgaatgttctcttaaaagttta
tacatcgttgaagagtgctatgaagaagttaaacaaaaattaattgaaaaattctttaat
ctggctgaaaagacaggaaatccgctttatgaaggtaatcaaattggtttttgcgataga
gatactaaagaatctgtgaaaaaccgcattattgacttagaaaaaatgggtctgattaat
attttagtaggcgtcaaatatgatcaagaacaggaaaatgtcagcttcaaaaatcacaaa
atgaatcctttgctattggaaacaaatgacgagttagttgacatattgacagcttcgcct
gcagttggaattctaactataatgaaatgtacggatattaatgacggaattgaaaaaata
aataaagtattagacaaaaagaggataggagttactttcttaggcaaagacctaaaagaa
actctgccggaggaagtaatgcttaaagctaacgctattcacttgaaagtcaacgtaaaa
actgtaaaaccggatttaacatgccatgatggacgtttttactttttacttttgactgaa
ttaaagagaattttgcgcagtgaatag

DBGET integrated database retrieval system