KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0676Help
Entry
Cbei_0676         CDS       T00547                                 

Definition
(GenBank) transposase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-IS66 DZR Mut7-C
Motif
Other DBs
NCBI-ProteinID: ABR32862
UniProt: A6LR82
Position
812698..813087
Genome map
AA seq 129 aa AA seqDB search
MSDGFKKKTKSLRTKSGKTPGGQKGHEGKTLEISDNPDEIIVHAVDKCDICGESLQDISP
ERHIIRQVVDIPEVKVKIIEHRAEVKKCPKCRRKNTGKFPDGITNSVRYGGKVKAVSVYL
TQYQMIPFK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagatggtttcaaaaagaaaactaaaagtttaagaactaaatctggtaaaactcca
ggtggtcagaaaggtcatgaaggtaaaactcttgagattagtgataatccagatgaaata
atagtacatgcagtagataaatgtgatatttgtggcgagtccttacaggatatatctccg
gaaagacacattattcgccaagttgtggatataccagaggtaaaagttaaaattattgag
catagagcagaagtaaaaaaatgtccaaagtgtagaagaaaaaataccggtaaattccct
gatggaataactaatagtgttcgatatggaggtaaggtaaaagctgtatcagtttattta
acacaatatcagatgattccatttaaatag

DBGET integrated database retrieval system