KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0677Help
Entry
Cbei_0677         CDS       T00547                                 

Definition
(GenBank) drug resistance transporter, EmrB/QacA subfamily
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_3 MFS_4 OATP ABC2_membrane_5
Motif
Other DBs
NCBI-ProteinID: ABR32863
UniProt: A6LR83
Position
813953..815407
Genome map
AA seq 484 aa AA seqDB search
MKEQKFNNHPNNKWIVLFVVVAMTFMATLDSSIVNVTLPVMSKNLEVPLSSIEWVIASYS
IIICSTILFFGRLGDMIGKTKVFQCGSVVFTLGSLLCGVSHSFISLIIFRFIQGIGGAAY
MANNHGIITEIFPREERGKALGILTTAVALGTMIGPPVGGIIASALNWHYVFLINIPIGV
IVFIIGIKYLPRIKRDSQKLDIAGAALQFLGISLFFGAFMLAQKTGFDNKWIMVALIVSI
ILIVLFIYIEIKSKHPLLALKIFKNKLFSVNLICAFISFTCIAASTILLPFYFQYTLEVS
PSKTGFLLMVSPIILAIFSPICGTLSDKIGSEILCLIGLTLMSIAFFLLSFLTEYSFILE
ATIFMALMSLGQSLFQPANNSLIMSNCPKEQLGIAGSVNSLVRNLGQIVGISLSTTILYL
FMSQKLHYQVLGYVFGKDYAFVYGMKNDYRILSMICCIGIVLNIVRVFKKKKTVDTKTEL
NSVK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaaaatttaataatcatccaaataataagtggattgtattatttgttgta
gtagctatgacatttatggctactttagattcaagtatagttaatgttacactacccgta
atgtctaaaaatttagaagttcctctttcatctattgaatgggttattgcgagctattct
attattatttgttcaactattttattctttggaagattaggtgatatgattggaaaaaca
aaagtctttcaatgtggaagtgtcgtgttcactttaggctctcttttatgcggagtttcc
cattcgtttatttcacttattatatttagatttattcaaggaataggtggagctgcttat
atggctaataaccacggcataataacagaaatatttccaagagaagagcgtggaaaagca
ttaggaattttaactactgctgttgccttaggaactatgattggaccaccagttggaggg
ataattgcctcagctttaaattggcattatgtttttcttattaatattccaataggagtt
attgtttttattattgggattaaatatctgccaagaattaaaagggatagccaaaaatta
gatatagcaggagcagctcttcaatttttgggaatatcattgttttttggtgcctttatg
ctagctcaaaaaacaggttttgataataaatggataatggttgctttaattgtgtctata
atcttaattgttttatttatatatattgagataaaaagcaaacatcctttacttgcatta
aaaatatttaaaaacaaactattttcagtaaatttaatatgtgcttttatttcttttaca
tgtattgctgcatctactatattattgccattttacttccaatatactttggaagtatcg
ccatccaaaacaggatttcttttaatggtatcgcctattatacttgcaattttttctcct
atatgtggtacactttctgataaaataggatcggagatattatgcttaataggtttaaca
cttatgagtatagcattttttcttttatcttttttgacagaatattcatttatattggag
gcaacaatttttatggcattaatgtctttaggacaatccttattccagccagcaaataat
tcccttattatgtcaaattgcccgaaagagcagcttggtatagctggaagcgttaattcc
ctagtaagaaacttggggcaaattgttggaatttctctgtcaactactattctataccta
tttatgagccaaaaattacactatcaagttttaggatatgtatttggaaaggattatgcc
ttcgtatatggaatgaaaaatgactatagaattttatcaatgatttgctgcattggcata
gtattaaatattgttcgagtattcaaaaagaaaaagactgtagatactaaaactgaactg
aactctgtcaaatag

DBGET integrated database retrieval system