KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0680Help
Entry
Cbei_0680         CDS       T00547                                 

Definition
(GenBank) O-methyltransferase, family 3
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_31 Methyltransf_25 PCMT Methyltransf_11 GCD14 Cons_hypoth95 Spermine_synth Methyltransf_15 TylF RrnaAD Methyltransf_23 DUF1726 CmcI Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ABR32866
UniProt: A6LR86
Position
819171..819800
Genome map
AA seq 209 aa AA seqDB search
MSKISVKNYISSLYQNYTIIKREEFIKNTSLDFFCPVIDTSVAIFLRILLKAIRPKKVLE
LGTSIGYSTTIIAETIAEWGGTVTTIELDKKVALAAKENFEKYNVLGNITLINDSVFDVL
PKIEEKFDLVFLDLFNNLYPDVMDSCINSLDQGGVLIADDTLFPALERRAYFVDSNKKVD
EFNRRLSEKSNVESILLPFDDGITIAIKK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatttcagttaaaaattatatttctagtctatatcaaaattatactatcata
aaaagagaagaatttataaaaaacacatctctagatttcttttgccctgtaatagataca
tctgtagctatatttttaaggatattacttaaggccattagacccaaaaaagtattagaa
cttggaactagtattggatattcaactacaataatagcagaaactatcgctgaatgggga
ggcacagtaacaactattgaattagataaaaaagtagcattagcagcaaaggaaaatttc
gaaaaatataatgtacttggtaatataactctaataaatgatagtgtattcgatgtttta
cctaaaatagaagaaaaatttgatttggtatttctcgacttatttaataatctttatcca
gatgttatggatagttgtattaattcactcgatcaaggaggtgttctaattgcagatgat
acactttttcctgcacttgaaagaagggcatattttgtagatagtaataagaaagtggac
gaatttaatagaagactaagcgagaaaagtaatgtggaaagtattcttcttccttttgat
gatggaataacaattgctataaaaaaataa

DBGET integrated database retrieval system