KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0682Help
Entry
Cbei_0682         CDS       T00547                                 

Definition
(GenBank) hypothetical protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding DUF4849 EST1_DNA_bind DUF4247
Motif
Other DBs
NCBI-ProteinID: ABR32868
UniProt: A6LR88
Position
821573..821830
Genome map
AA seq 85 aa AA seqDB search
MNNNLKNEIEEMIKKLSMSHDDEESDNKVEETAEEYLKYIDSIRFIELITAIESKYDIEI
DNKDLVRENTKELDTFVSMVGKYMK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatttaaagaatgaaattgaagaaatgataaaaaaattatcgatgtcacat
gatgatgaagagagtgataataaagttgaggaaactgcagaagaatatcttaaatatatt
gattcaataagatttatagagttaataactgcaattgaaagtaaatatgatatagagata
gataataaagaccttgtaagagagaacacaaaagaattagatacatttgtttcaatggtt
gggaaatatatgaaatag

DBGET integrated database retrieval system