KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0684Help
Entry
Cbei_0684         CDS       T00547                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Orthopox_F6 RepB-RCR_reg
Motif
Other DBs
NCBI-ProteinID: ABR32870
UniProt: A6LR90
Position
823312..824625
Genome map
AA seq 437 aa AA seqDB search
MKQDVSYKGEFVSDDFWHVNTRKIVLMLKQKKIGYKDIVICKSNSHIGVYIHWLACVEIG
FIPIFVSSEFSIDSIKLLNNNIGAKVVLESVGTDHYVYLISDTCSKSPFLNNIKENSIIH
LTSATTGNPKLVVRTKEQIDSEITRYSKYLNIDENDSILPIVPIYTSFGFISGMLLSMKV
NAKLILPDIILPRNIIQLSNLNKATVMLGVSYFYRKMLAISSKYTLNNELRYVISSGGPM
EEGLQKDFKDRFGIKLLQQYGSTETGSLCIGCSEDSYRSVGKPIPGVKFKIINDKDDKPW
VYVSSPTTIGAYMTKDGIVELDKTLYKIGDLGRIKENGEVELLGRSDDILVVDGKKVDKK
MVASVIKKINCIDKVNIFLTKNNDTTELTCEYCSDKKVTKETFVNHCKMVLANYQIPKKF
LKVNEMKNVGRSSWKTE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagatgtaagttataagggtgaatttgtttcagatgatttttggcatgtaaat
actaggaaaatagtattaatgttaaaacaaaaaaaaattggatataaagatatagttata
tgtaaatcaaattctcatattggagtttatattcattggttagcatgtgttgaaataggg
tttattcctatatttgtatcttcagaattttcaattgatagtattaaattattgaataac
aatattggagcaaaagtagttttggagagtgtaggcacagatcattatgtatatttgatt
tcggatacttgttcaaagtctccatttttaaataatattaaggaaaattcaataattcac
ttgacttctgcaacaactggaaatcctaaattagtagtaagaacaaaagaacagattgat
tctgaaattactagatattcaaaatatttaaatatagatgagaatgactctattttgcct
atagtacctatttatacttcgtttgggtttatatccggaatgctgcttagtatgaaggta
aatgctaagttaatacttcctgatatcatattacccagaaatataatacaactaagtaac
ttaaacaaagctactgtgatgttgggagtttcatacttttatagaaaaatgttagctatt
tctagtaaatatacattaaataatgagttgaggtatgtaatttcatcagggggaccaatg
gaagaaggactacaaaaagattttaaagatagatttggaataaaattattacagcaatat
ggttcaacagaaaccggtagtttatgtattggctgctcagaggacagctatagaagtgta
ggaaagccaataccaggtgttaaatttaaaattattaatgataaagatgataaaccatgg
gtatatgtatcttcaccaacaacaataggtgcttatatgactaaggatggaattgttgaa
ttagataagacactatataaaattggggatttaggtagaataaaagaaaatggagaagtt
gaattattgggtagaagcgatgatatattagtcgttgatggtaagaaggttgataaaaaa
atggttgcttcagttataaaaaaaatcaactgcattgataaagtaaatatttttttaact
aaaaacaacgatacaactgaattaacttgcgagtattgcagtgataaaaaagtcacaaag
gagacttttgtaaatcattgtaagatggttcttgctaactatcaaataccaaaaaaattc
ttaaaagtaaatgaaatgaaaaatgtgggtagaagctcatggaaaacagaataa

DBGET integrated database retrieval system