KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0685Help
Entry
Cbei_0685         CDS       T00547                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N Glu_dehyd_C ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ABR32871
UniProt: A6LR91
Position
824806..825927
Genome map
AA seq 373 aa AA seqDB search
MKTKVLLIKADEEPMKAVENPMPNQIYKNPHIMIEERTLGTLDPDKIRIQMLYVGVCGSD
IHILKSNPETGYICSSVPVEIPEEGRIIGHEGVGLVLDVGSNVKEIEKGMYVTLESILVC
NNCDVCKRGDFNQCRNAKLIGLEVDGVMGNVVDVNSNLAHDVTGYIKSEDDLIAMACVEP
MGVAYDACENAKIKAGDVVVIFGGGPIGIYTAMLSKLVFGASQVHVVEPVEFRRNLLREW
TKYVYDSLDSLKKNLKEANVIIETSGDLNNVNKVFNIIDANGKVVLLARSGEPLFIDAVD
HMITNNISIVGSRGHLCGAFDRILRLHASNRIKLDSIVTSVVNGLEDLKKVLESKDIVKD
NCKVVVSLKDINN
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaagtattgttaattaaagctgatgaagaaccaatgaaagcagttgaaaat
ccaatgccaaatcaaatttataagaatcctcatattatgattgaagaaagaacgttagga
acgttagatcctgataaaattaggatacagatgctttatgttggggtttgcggttcggat
attcatatacttaaaagcaatcctgaaactggatacatatgtagttctgttcctgttgaa
attccagaagagggtaggattattgggcatgaaggagttggccttgttttagatgttgga
tcaaatgttaaagaaatagaaaaaggtatgtatgttactttggaatcaattcttgtttgt
aataattgtgatgtttgtaaaagaggagactttaaccagtgcaggaatgccaaactaata
ggtttagaagttgatggagttatgggaaatgttgttgatgtaaattctaatttagcacat
gatgttactggttatataaaaagtgaagatgatttaatagctatggcatgcgttgagcca
atgggtgtagcttatgatgcttgtgaaaatgctaaaataaaagccggagatgttgttgtt
atttttggaggaggtccaattggaatatatactgcaatgttaagcaagttagtatttgga
gcatcgcaagtgcatgttgttgagccagttgaatttcgtagaaatttacttcgagaatgg
actaaatatgtatatgatagtcttgattctctaaaaaagaatttgaaagaagctaatgtt
attattgaaacatctggtgatttaaataatgtaaataaagtattcaatataattgatgca
aatggaaaagttgtgcttttagcaagaagcggtgagccactttttatagatgctgttgat
catatgattactaataatattagcatagtggggtcacgtggccatttatgtggtgcattt
gatagaattttaaggctgcatgcatctaaccgaataaaattagatagtattgtaacttct
gttgttaatggtttagaagatcttaagaaagtattagaaagtaaagatatagtaaaagat
aattgtaaggtagttgtaagtcttaaagatattaataattaa

DBGET integrated database retrieval system