KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0686Help
Entry
Cbei_0686         CDS       T00547                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ABR32872
UniProt: A6LR92
Position
826026..827726
Genome map
AA seq 566 aa AA seqDB search
MINITYKTLCEAFLDMHNYNETHTFIENADNEINITSEDLKSRVLKILHYMQYIGVKPGD
EVVFQIKSNIDFVHVFWACLLGRIIPVPYTYLESERDKLKLLKIWNNLKNPFLATDIDSF
EKLKKFIYKNDLSFKLQGIINKVIITEEMEKLDENVEIILPNESDIAFVQFSSGSTNDPK
GVIITHKNIISSVREAVKAMKISEEDIYLSWLPLTHSFGLIGTYITPFLARLKYYIMPSN
LFVTYPLLWVKKMSEHNVTITAAPNFALKHVCKYISIEKDIDMDLSALRIIIDGAEPVSP
DTCREFNEKMYDFGMKNTTVRPSYGLSEATLVVTTPKCPQEFREVNVMRNHVKIGEKIIE
SDIKNDNVISFVEVGACIGNCEIKIINDDGEKVGDRVVGSVLLRGDMISTGYYNNPEATK
NSMDKYGWYNTGDLGFLRDGNLVLTGRVKDVIFVKGENYYSHDIENICQQVNDAKFSRVA
VCGVYNHKMKQDQVICFLEYDGDVEMFNDISLGIKRHVIKKIGIGISHVIPIKKIPVTVS
GKMKRYILSQQFMKGDFDETIQKILS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgattaatattacttataaaactttatgtgaagcttttttggatatgcataattataat
gaaactcatacttttattgaaaatgctgataatgaaattaacattacatcagaagattta
aaatcaagagtgttaaagattttgcattacatgcaatacattggtgttaaaccaggagat
gaggttgtttttcagattaaaagtaatatagattttgtacatgttttttgggcatgcctt
ttaggtaggattataccagtcccatatacataccttgaatcagaaagggataaactaaag
ttacttaaaatttggaacaatttaaaaaatccatttttagcgacagatatagacagtttt
gaaaaattaaaaaaatttatttataaaaatgatttgagtttcaagcttcaggggattatt
aataaagttataataactgaagaaatggagaaattagatgaaaatgttgaaataattctt
cctaatgaatcagacattgcatttgtacaattttcatctggttcaactaatgatccaaag
ggggttattataacacacaaaaatattatttctagtgtaagagaagctgtaaaagcaatg
aaaatatctgaagaggatatttatctaagttggcttcctttaacacatagttttggtctt
atagggacttatataactccatttttggctagacttaaatattatattatgccatcaaat
ttatttgtaacctatccgctactatgggtgaaaaaaatgtctgaacataatgtaacaata
actgcagcacctaattttgctcttaaacatgtatgtaaatacatatcgattgaaaaagat
attgatatggatttatctgcattaaggataataattgatggcgctgaaccagtttcacca
gatacttgtagagaatttaatgaaaaaatgtatgattttggaatgaaaaatacaactgta
cgaccatcatatggtttgtctgaagctacgttagtagtgaccactccaaaatgcccacaa
gaatttagggaagttaatgttatgagaaatcatgttaaaataggtgaaaaaataattgaa
agtgatattaaaaatgataatgttataagttttgtagaagttggggcatgtataggtaat
tgtgaaatcaaaattattaatgatgatggcgaaaaggttggggaccgagtagtaggttct
gttttacttagaggcgatatgatttctactggttattacaataatccagaagcaactaaa
aattcaatggataaatatggatggtataatacaggagatttaggtttcctaagagatggt
aatcttgtacttaccggaagagtaaaagatgttatatttgtaaaaggagaaaattattat
tctcacgatattgaaaacatttgtcaacaggttaatgatgcaaaatttagcagagttgca
gtatgtggcgtatacaatcataaaatgaaacaagatcaagttatttgttttttggaatat
gatggtgatgtagaaatgttcaatgacatttcattaggaataaaacgtcatgtaattaag
aaaataggtataggtattagtcatgtcattccgattaagaaaattcctgttactgtgagc
ggtaaaatgaaaagatatatactttcgcagcaatttatgaaaggtgattttgacgagaca
attcagaagattttatcttaa

DBGET integrated database retrieval system