KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0688Help
Entry
Cbei_0688         CDS       T00547                                 

Definition
(GenBank) beta-lactamase domain protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: ABR32874
UniProt: A6LR94
Position
828508..829182
Genome map
AA seq 224 aa AA seqDB search
MDTMYSINQLKVGSINNCTYIIINNDIKEAVIIDPAWDLEKIVANLNTNGVSLSSILLTH
SHYDHTNLVEPLLKIFNCQVYMAKKEINYYGFRCKNLNPVNDSDKISIGKLKMDCVLTPG
HTAGGMCFKLENKLFTGDTIFIRGCGICTCKGGDYNEMFESIKKIKEIAKKNVLIYPGHY
FEGDLKYESEYLKRNIYFHINDKEVFKKVITLSSKKNDYAKYEQ
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttggatactatgtatagtataaatcaattaaaggttggaagtattaataattgtacatat
ataattattaataatgatataaaagaagccgtaattattgatccagcatgggatttagaa
aaaatagtggcaaatcttaatacaaatggtgtatccctaagctcaattttattaacccat
tctcattatgaccatacaaatttagtggaaccattattgaaaatttttaattgtcaagtt
tatatggctaagaaagagatcaactattatggatttagatgtaaaaatctgaatccggta
aatgattcagataaaataagtattggcaaattaaaaatggactgtgtgttaacgccaggt
catacagctggaggcatgtgttttaaacttgaaaacaagttatttacaggagatacgata
ttcatacgaggttgcggcatatgcacttgtaaaggtggggattataatgaaatgtttgaa
agtataaaaaaaattaaagaaattgctaaaaaaaatgttttgatttacccggggcattat
tttgaaggtgacttgaaatatgaatcggagtatttaaaacgaaacatatatttccatatt
aatgataaagaggttttcaaaaaagtaataacattaagtagtaaaaaaaatgattatgca
aaatatgaacaataa

DBGET integrated database retrieval system