KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0692Help
Entry
Cbei_0692         CDS       T00547                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01130  Biosynthesis of antibiotics
cbe01230  Biosynthesis of amino acids
cbe02024  Quorum sensing
Module
cbe_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cbei_0692
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cbei_0692
Enzymes [BR:cbe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Cbei_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ABR32878
UniProt: A6LR98
Position
832744..833772
Genome map
AA seq 342 aa AA seqDB search
MSFLCVRKIPSPEEIKKLIPLENNLKEIKSERDAEVKEILAGKSNKFIVIIGPCSADDEN
SVCEYVNRLAKVNEEVKDKLFIIPRIYTNKPRTTGNGYKGMFHQPNPEKSPNIFDGLISI
RKMFIRSIKESHLTSADEMLYPSNHMYYDDLLTYTTVGARSVENQQHRLTASGVDIPVGM
KNPTSGDISVMFNSIQAAHSKHNFLYRYNEVNTTGNPYAHVIMRGSVNQHGKNIPNYHYE
DLMRVAEAYNKYDFPYPAVIVDANHANSMKIFSEQPRIVQEVLNTRKYNCDIKNLVKGVM
VESYIEEGCQKIDDHIYGKSITDSCLGWEATEKLLYYIAEQV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagttttctatgtgtaagaaaaataccatctccagaggaaattaaaaaattaattccc
ctggaaaataatctaaaagagattaagagtgaaagagatgcagaagttaaagaaatactt
gctggaaaaagcaataaattcattgttatcataggaccgtgttcggcagacgatgagaat
tctgtttgtgagtatgttaacagattggcaaaagtaaatgaagaagttaaggataaactt
tttattattcctagaatatatacaaataagcctaggactacaggtaatggatataaaggg
atgtttcatcaaccgaatccagaaaaatcacctaatatttttgatggactaatttctatt
agaaaaatgtttattcgttcaataaaagagtcgcatcttacatctgctgatgaaatgctg
tatccttcgaatcatatgtattatgatgatttattaacttatacaacagttggagcgaga
agtgttgaaaatcaacagcatagattaactgctagtggtgttgatattcctgttgggatg
aaaaatccaacaagtggtgatatatcagtaatgttcaattcaatccaagcagcacattca
aaacataatttcttatacagatataatgaggtgaatacaactggtaatccatatgctcat
gtaattatgcgtggttcagttaatcagcatggtaaaaatatacctaattatcactatgag
gatttaatgagagttgctgaggcttataataaatatgattttccatatcctgcagtaatt
gttgatgcaaatcatgctaattcaatgaaaattttttcagaacaacctcgaatagtacaa
gaagtacttaatacaagaaagtataattgtgatataaaaaatttagttaaaggtgttatg
gttgaaagctatatagaagaaggatgtcaaaaaattgatgatcatatatacggtaaatca
attactgattcttgtttaggttgggaagcgaccgagaagttgctttattatattgctgaa
caagtataa

DBGET integrated database retrieval system