KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0694Help
Entry
Cbei_0694         CDS       T00547                                 

Definition
(GenBank) RNA-directed DNA polymerase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RVT_1 RVT_N GIIM Intron_maturas2
Motif
Other DBs
NCBI-ProteinID: ABR32879
UniProt: A6LR99
Position
complement(834710..835891)
Genome map
AA seq 393 aa AA seqDB search
MLIDYKPESLRQQKNGDNNKAKRLQYLLTHSFSAKAYAVRKVTTNKRKNTSGVDKKLWYT
SASKMKAVLSLTDKNYKAKPLKRVYIEKKGKKQKRPLGIPTMYDRAMQTLYALALEPIAE
TKGDSISFGFRRGRSAKDACEQIFCVLARKCSPTWILEGDIKGCFDNINHEWLQNNIPMD
KIIMKQFLKSGYIYEEKLFPTETGSPQGGAISSIYANMTLDGLEKVIQDKYHRNSKGKIE
NHYRAKTKVNLIRYADDFVITANSKEIAEELKTTVSQFLQSRGLALSEEKTAITHIDKGF
DFLGWTFKKYRGKLIVKPSKNSIKNIIRKCSTIILKEGKASTQSDLIRRLNQVVRGWTNY
HKHVVFQILTTPFISYYSNGQNIDIPIRTNGGD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttaatagactacaaacccgaatcgctaaggcaacaaaaaaatggagacaataataaa
gccaaaagattacaatacttattaacccactctttttcagctaaggcttatgctgtaaga
aaagtaacaacaaataaaaggaagaatacatctggagtagacaaaaaactatggtatacc
tctgcctcgaagatgaaagctgtgctttcacttactgacaaaaactataaagcaaaacct
ttaaaacgagtatatatcgaaaagaaaggtaagaagcagaaacgtccattaggtatacca
acaatgtatgatagagcaatgcaaacattatatgcattagcgcttgagccaattgcagaa
acaaaaggtgattccatttcctttggattccgccgtggacgaagtgcaaaagatgcctgt
gagcagatattttgtgtattagctagaaaatgttctccaacatggatacttgaaggtgat
attaaaggttgttttgataatattaaccatgaatggttacaaaacaatataccaatggat
aaaattattatgaagcagttcctaaaatcaggatatatatatgaagaaaagctgtttcca
acggaaacaggttcgccacaaggcggtgcaatctcaagtatatatgcaaatatgacatta
gatggactcgaaaaagtgattcaagataaatatcatagaaattcaaaaggtaaaatagaa
aatcattacagagccaaaactaaagtgaacttgattcggtatgctgatgactttgttatt
actgcaaactcaaaagaaattgctgaagaacttaaaactacggttagtcaattcctccaa
tcaagaggtctagcactatcagaagaaaagactgcaattacacatatagataaagggttt
gactttcttggctggacatttaagaaatacagggggaaattaatagtgaaaccttctaaa
aattcaattaaaaacataattaggaaatgttcaacaataatccttaaggagggtaaagct
agcacccaatctgacctaataagaaggcttaatcaagtcgtaagaggttggacaaattac
cacaaacatgttgtttttcaaatattaacaacaccctttatcagttactacagcaatggg
caaaacatagacatcccaataagaacaaatggtggagattaa

DBGET integrated database retrieval system