KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0696Help
Entry
Cbei_0696         CDS       T00547                                 

Definition
(GenBank) guanine-specific ribonuclease N1 and T1
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease ETRAMP LPAM_1 O-antigen_lig
Motif
Other DBs
NCBI-ProteinID: ABR32880
UniProt: A6LRA0
Position
838318..838839
Genome map
AA seq 173 aa AA seqDB search
MKKIFMHKISAVFILLLMFIGLFGCAATNKTAENKQQDNHVEATKSEDKKIDSSQDGDSK
NKKIINDFQGVADYIHKNGTLPENFITKAQANKLGWKPGDDLSKVAPGKSIGGDIFKNAE
KSLPDAPNRIWHECDINYNGGHRGDDRILYSNDGLIYSTSDHYKTFKLLYKGK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatttatgcataaaatctctgctgtttttatacttttacttatgtttata
ggtttatttgggtgtgcagcaacaaataaaactgctgagaataagcagcaggataaccat
gtggaagctacaaaatcagaagataaaaagatagattccagccaagatggagattcaaag
aataaaaaaattattaatgattttcaaggcgttgcagattatatacataaaaatggaact
ttgcctgaaaattttataacaaaagcgcaggctaataaacttggatggaagccaggagac
gatcttagcaaagtagcgcctggtaaaagcatagggggagatatttttaagaatgctgaa
aaatctctaccagatgcgcctaatagaatttggcatgaatgcgatattaactataatgga
ggacatcgtggggatgataggattctttattcaaatgatggattaatttactctacctca
gatcattataaaacattcaaattattatataaaggaaagtag

DBGET integrated database retrieval system