KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0697Help
Entry
Cbei_0697         CDS       T00547                                 

Definition
(GenBank) Barstar (barnase inhibitor)
  KO
K03623  ribonuclease inhibitor
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    Cbei_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Barstar IspA
Motif
Other DBs
NCBI-ProteinID: ABR32881
UniProt: A6LRA1
Position
838861..839145
Genome map
AA seq 94 aa AA seqDB search
MNKVVIQGSKLTDRNMLHQILKQELKLPAHYGENLDALWDCLTADIQLPVTIEWVDFQKS
KDLLGDYAENTLEIFNEAEKFTGGKLKIKIISNF
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaagtagtaatacaaggcagtaagcttacggatagaaatatgttacaccaaatt
ttaaaacaggaattaaagcttcctgctcattacggtgaaaacttagatgcactctgggat
tgtctaacagctgatattcaattgccagttacaattgaatgggttgactttcaaaaaagt
aaagacttattaggtgattatgctgaaaatacattagaaatttttaatgaagctgaaaaa
tttactggaggaaaacttaagataaaaattatttccaacttttaa

DBGET integrated database retrieval system