KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0700Help
Entry
Cbei_0700         CDS       T00547                                 

Definition
(GenBank) glycoside hydrolase, family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00010  Glycolysis / Gluconeogenesis
cbe00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_0700
   00500 Starch and sucrose metabolism
    Cbei_0700
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Cbei_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ABR32884
UniProt: A6LRA4
Position
841710..843134
Genome map
AA seq 474 aa AA seqDB search
MSKYSFPEEFLWGGAIAANQAEGAYREDGKGLSTVDVIPHGINRMKVKLGLEEDLALKDN
EFYPSHEAIDFYHHYKEDIALMAEMGFKVFRTSIAWTRIFPNGDDSKPNEAGIKFYKDLF
LECKKYNIEPLVTLCHFDVPMELVNKYGSWKSRKMISFFENYARCCFKEFDGLVKYWLTF
NEINILIHSPFSGAGIYFKEGENKEQVKYQAAHHMLVASALVTKIAHEQNPENKVGCMLA
GGDFYPYSCDPRDVWMAHTKDRENLFFIDVQARGKYPSYSKRVFAEKEVSIVMEENDLDI
LKNTVDFISFSYYASRCASKDMENQTEANVVKSIKNPHLEVSEWGWAIDPLGLRITMNTL
YDRYEKPLFIVENGLGAKDTIEEDGSINDDYRIDYLRQHIMEMKEAMEDGVELLGYTSWG
CIDLVSASTGEMSKRYGFVYVDKQDDGTGTLERKRKKSFYWYKKVIETNGECLI
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatacagtttcccagaagaatttctgtggggcggagctattgcagcaaatcag
gctgaaggtgcttatagagaagatggaaaaggtttaagcactgtagatgttataccacat
ggaataaacagaatgaaagtaaaattagggttagaagaagatttggctttgaaagataat
gaattttatccaagtcatgaggcgattgatttttatcaccattataaagaagatattgct
ctgatggctgaaatgggatttaaagtttttagaacttcaatcgcatggacaagaatcttc
cctaatggagatgatagtaaacctaatgaagcaggaattaaattttataaagatttattt
ttagaatgtaaaaaatataatatagagccattagtaacattatgtcactttgatgttcca
atggaactggttaataaatatggatcatggaagagtagaaaaatgatatcattttttgaa
aattatgcaagatgctgctttaaagaatttgatggcttggttaaatactggctgacattt
aatgaaataaatatattgatacatagtcctttttcgggggcaggtatatatttcaaagaa
ggtgaaaacaaagagcaggttaagtatcaggcagctcatcatatgttagtagcaagtgct
ttagtaactaaaatagcccatgaacaaaatccagaaaataaagttggatgtatgcttgca
ggaggagatttttatccgtactcatgtgatccaagagatgtatggatggctcatacaaag
gatagagaaaatttatttttcatagatgtacaagctagaggtaagtatccatcatactca
aagagggtatttgcggaaaaagaagttagtattgtaatggaagaaaatgatttggatata
ttaaaaaatacagtagattttatatcttttagttattatgcttctagatgtgcatctaag
gatatggaaaatcaaaccgaagctaatgttgttaaatccataaaaaatcctcatttagaa
gttagtgaatggggatgggctattgatccgttaggtcttagaataactatgaatacgcta
tatgataggtacgaaaagcctttatttatagtagaaaatggactaggtgctaaagataca
atagaagaggatggctcaataaatgatgattacaggattgattatcttagacagcatatc
atggaaatgaaagaagccatggaagatggagttgaactattaggatatacatcttgggga
tgtatagatttagtttcagcatccactggagagatgagtaaaagatatggatttgtatat
gtagataaacaagatgatggaactggaactttagagagaaaaagaaaaaaatctttttat
tggtataaaaaagtaatagaaacaaacggtgaatgtttaatataa

DBGET integrated database retrieval system