KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0702Help
Entry
Cbei_0702         CDS       T00547                                 

Definition
(GenBank) transcriptional regulator, DeoR family
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR HTH_11 HTH_Mga GntR MarR Fe_dep_repress TrmB Put_DNA-bind_N IF-2B Rrf2 HTH_24 FeoC HTH_5 HTH_AsnC-type HTH_27 CoA_trans HTH_Crp_2 HTH_20 DUF977 HTH_34 SgrR_N
Motif
Other DBs
NCBI-ProteinID: ABR32886
UniProt: A6LRA6
Position
844586..845338
Genome map
AA seq 250 aa AA seqDB search
MTSRYTKLLEIVNENKRIEVSKLSELLNVSQVTIRKDLGALEEKGLLKREHGYAVMTSSD
DINSRLAFNYDIKRKIAQLASKLVNDGETVMIESGSSCALLAEELAYNKKDITVITNSTF
IANYIREGNAKVVLLGGDYQPESQVSVGPLTRKCVKDFFVDKLFIGTDGYNSKIGFTGKN
LMRTETVKAMAESSNKIIILTESSKFSERGVVSQFKAEEISYLFTDTNIPEDVLESLKKE
KVDVQMVSVE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaggtatacaaagcttcttgaaattgtcaatgaaaacaagcgtatagaagtc
agtaaattatcagagcttttaaatgtatctcaagtgactatacgtaaagatcttggtgca
ttagaagaaaaaggattattgaagcgtgaacatgggtatgcagttatgacttcaagtgat
gatatcaatagcagattagcttttaattatgatataaaaagaaaaatagcacaattggca
agtaaacttgttaatgatggtgaaacagttatgattgaatcgggctcatcttgtgcctta
cttgctgaagaactcgcatataataaaaaggatataacagtaataactaattctacattt
attgcaaactatattagagaaggaaatgcgaaagtagtgttgcttggaggagattaccag
ccggaatctcaggtatcagtaggccctctaacaagaaagtgcgttaaagatttttttgta
gataaattgtttatcggaactgatggttataattctaaaatagggtttacaggaaaaaac
ttaatgcgtacagaaacggtaaaagccatggctgaaagttctaataaaattataatatta
acagaatcatcaaagttttctgagcgtggagtggtatctcaatttaaagcagaagagata
agctatttatttacagatactaatattcctgaagatgttttagaaagtttaaagaaggaa
aaagtggatgttcaaatggtaagtgtagaataa

DBGET integrated database retrieval system