KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0704Help
Entry
Cbei_0704         CDS       T00547                                 

Definition
(GenBank) transcriptional regulator, XRE family
  KO
K07729  putative transcriptional regulator
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cbe03000]
    Cbei_0704
Transcription factors [BR:cbe03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    Cbei_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_26 HTH_31 HTH_11 HTH_24 HTH_25 HTH_7 Sigma70_r4 HTH_37 HTH_Crp_2 YdaS_antitoxin GntR HTH_AsnC-type Mu-transpos_C
Motif
Other DBs
NCBI-ProteinID: ABR32888
UniProt: A6LRA8
Position
complement(846193..846402)
Genome map
AA seq 69 aa AA seqDB search
MQTRIQELRKEKKITQGELADAVNVTRQTIISLENGRYNASLILAHKIAQFFEISIEEIF
IFDKEDENL
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
ttgcagactagaatacaagagttacgaaaagaaaagaagataactcaaggtgagcttgca
gatgcagtaaatgtaacaagacagacaattatatcacttgaaaacggaagatataatgct
tccttaatactggcacacaaaattgcacaattttttgagatttctattgaagagatattt
atttttgataaggaggatgagaatttatga

DBGET integrated database retrieval system