KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0706Help
Entry
Cbei_0706         CDS       T00547                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_24 Fe_dep_repress TrmB GntR Replic_Relax
Motif
Other DBs
NCBI-ProteinID: ABR32890
UniProt: A6LRB0
Position
complement(849348..849791)
Genome map
AA seq 147 aa AA seqDB search
MENISKLNAAIYRNAQSIINSKLIDLNIRSGQHDFLYVISKNEGISQKELSEFLYVGKST
TAKAVKNLVENDYVKRIQDENDKRIYRLYLTDAGKKVIPKIDATFLELVAIFSKSLSKKE
EEQTVIILKRILHTISEEKHKINSDID
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacattagtaaacttaatgcagcaatttatagaaatgctcaaagcataataaat
tcaaagcttatagatttaaatattagaagtggccaacatgattttttatatgtgatttca
aaaaatgaaggtataagtcagaaagagttaagtgagtttctgtatgtaggtaaatcaact
actgcaaaagcagtaaaaaatctagtagaaaatgattatgtaaaaagaattcaagatgaa
aatgataagcgtatttataggttatatttaacggatgcaggaaaaaaagttatacctaaa
atagatgcaacctttttagaattagttgctattttttctaaaagcttatctaagaaagaa
gaagaacaaacagtcattattctaaagagaatcctacatacgatttctgaagaaaaacat
aaaattaattctgatattgattaa

DBGET integrated database retrieval system