KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0710Help
Entry
Cbei_0710         CDS       T00547                                 

Definition
(GenBank) histidine kinase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA DUF1638 HATPase_c_3 HATPase_c_5 LPP
Motif
Other DBs
NCBI-ProteinID: ABR32894
UniProt: A6LRB4
Position
853446..855791
Genome map
AA seq 781 aa AA seqDB search
MNDKLCILICESFKAEVESMRGVLKNGEIEFKYYSMDCINCNRQRQKLYDGLIESGYCGD
SVILLPTQKGSGKDENLVGESIFNSCLSLLAGGDLINYLSLMGYYLTTPGWLKRWKHIIM
DIYGFNQETAREFFSEYCKKVVLIDSGVYSNIMTDLIEFSEYIGMKYEIIDVGLEYFSSI
INNSYKNWKVNRLEYILNLKNKQVTDYALVFDFLEKKATLLKREDLIKNIFTLFEMLTGA
KHLAFLPVIEHKKGEIIFNQEKLYKSELYDIDNSEFRQSYFLTASGAGFIFKITFNNELM
GYMEVEDIMFPNYMESYLDLSKTIMIILGIMLFNSKIYEKLIDTNEELLSLNNELEVLVD
KRTSQLLEVNGSLEETNCMLEEEIEEHKLTETKLKAAKEEAERANSAKSQFLANMSHEIR
TPMNGIMGMTSLLEFSKLTDEQIDIVKMIETSSKHLLQIINDILDLSVMDVGKIELKPER
INIFNLMNESRNLFTYLAENKGLKLEIIVDNNLPNEIILDKGRLMQVLSNLIGNAIKFTE
KGKIQVSVDKVEDKENKVKLMFSVKDTGIGIKEEDIPRLFNYFTQLDISASKKFQGTGLG
LAISKNIVELMGGEISVESQYGKGSTFYFTCLFNIASDSKESSNIQKMCIDNKAYLETRI
LQVEDDIISQRFMNQLCKIAGWKIKIASNGLEALNILENEDFDIILMDIQMPDMSGIELT
KIIREKEKLTGKHITIIAMTAYAMGGDRDICINTGMDDYISKPIEVMKLKEVITKYSSNY
K
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataaactatgtattttaatttgtgaaagtttcaaagctgaagtggagagtatg
cgaggcgttttgaaaaatggagagattgaatttaaatactattcaatggattgtataaat
tgcaatcgtcaaagacagaaattatacgatggccttattgaatcaggttattgtggtgac
tcagttattttgcttccaactcagaagggctctggaaaagatgagaatcttgttggtgaa
agtattttcaattcatgcctgtcattattggctgggggtgatctgataaattacctttct
ttaatggggtattatttgactacaccaggttggctaaaaagatggaagcatattattatg
gacatatatggatttaatcaagaaactgcacgtgaatttttttcagaatactgtaaaaag
gtggttcttattgacagtggcgtatatagcaatatcatgactgatttaatagagttttca
gaatatataggaatgaaatatgaaattatagatgtaggtttggagtacttttcaagcatt
ataaataattcatataaaaattggaaagttaatagactagaatacattttaaatttaaaa
aacaagcaggtcactgattatgctcttgtatttgattttcttgaaaaaaaagcaacactt
ttaaaacgtgaagacctgattaagaatatttttactttatttgaaatgttgaccggtgct
aagcatctcgcatttcttcctgtaattgaacataaaaaaggagaaataattttcaatcaa
gagaagttgtataaaagtgaactatatgatatcgacaactcagaatttaggcaaagttat
tttcttactgcctcaggagcaggatttatttttaagataacttttaataatgaattaatg
ggttatatggaagtggaagatattatgtttcctaattatatggaaagttatttagattta
tcaaaaacaatcatgataattctaggaataatgctttttaattcaaagatttatgagaaa
ttaattgatacaaatgaagaacttctttcattgaataatgagcttgaggttcttgttgat
aaacgtacttctcaactgttggaggttaatggaagcctcgaagaaacaaactgtatgtta
gaagaagaaatcgaagagcataagttaactgagactaagcttaaagctgcaaaagaggaa
gcagaaagagcaaactcagctaaaagtcagtttttagcaaatatgagtcatgaaataagg
acacctatgaatgggattatgggaatgactagcttattggaattttcaaagttgacagat
gagcaaattgacatagtaaaaatgattgaaacttcttcaaaacatcttcttcagattatt
aatgatatacttgatctctcagtaatggatgtaggcaagatcgaactaaagccagaacgc
ataaatatatttaatttaatgaatgaaagtagaaatttatttacatatttagcggagaat
aaaggactgaagcttgagattattgttgacaataatttaccgaatgaaatcatattagat
aagggtagattaatgcaagttttaagcaatttaataggaaatgcaattaagtttactgaa
aaaggtaaaattcaagtatccgtagataaagttgaggataaagagaataaagtgaagcta
atgttttctgtaaaagatacagggattggaattaaggaagaagacattccgagattattt
aattattttacacaattagatatatcagcttcaaaaaaatttcaagggactggtctgggt
cttgctatttctaaaaatatcgttgagcttatggggggagaaatatctgttgaaagtcag
tatggtaaaggaagtacattctactttacttgtttgtttaatattgctagtgatagtaag
gaatcatcaaatattcaaaaaatgtgtatagataacaaggcttatttagaaactaggata
ttacaagttgaagatgatattatcagccagcgatttatgaatcaattatgtaagattgca
gggtggaaaataaaaatagcttcaaatggattagaagcattgaacatacttgaaaatgag
gattttgatataattcttatggatattcagatgccagatatgagcggaattgaacttaca
aaaataattcgggaaaaagaaaagttaactggtaaacatattactataatcgcaatgaca
gcatatgcaatgggaggagatagagatatatgtattaatacaggaatggatgactatatt
agtaaaccaattgaagttatgaaacttaaagaagttattactaagtatagcagcaattat
aaatag

DBGET integrated database retrieval system