KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0713Help
Entry
Cbei_0713         CDS       T00547                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose family, IID subunit
  KO
K02796  PTS system, mannose-specific IID component
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00051  Fructose and mannose metabolism
cbe00520  Amino sugar and nucleotide sugar metabolism
cbe01100  Metabolic pathways
cbe02060  Phosphotransferase system (PTS)
Module
cbe_M00276  PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cbei_0713
   00520 Amino sugar and nucleotide sugar metabolism
    Cbei_0713
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Cbei_0713
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbe02000]
    Cbei_0713
Transporters [BR:cbe02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    Cbei_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIID-AGA
Motif
Other DBs
NCBI-ProteinID: ABR32897
UniProt: A6LRB7
Position
858548..859459
Genome map
AA seq 303 aa AA seqDB search
MSKELKLTKRDRISVWFRSFFLQGSWNYERMQNGGWAFAMIPAIRKLYKTKEERAAALER
HLEFFNTHPYVASPVVGVTLALEEERANGAPIDDVTIQGVKIGMMGPLAGIGDPVFWFTV
RPILGALAASLALGGNILGPIIFFFAWNIIRMAFMWYTQEFGYKAGSRISEDLSGNMLQD
ITKGASILGMFILGSLVNRWVSVKFAPVVSSVKLSDGAFIDWSKLPAGAEGVKQALLQQA
SGMSLTDTKITTLQNNLDSLIPGFVGLLITLLCMWLLKRKVSPILIILGLFIIGIVFHLI
GLM
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaattaaaattaacaaaaagagaccgtatttctgtttggttccgttcattt
ttccttcaaggttcttggaactatgaaagaatgcaaaatggtggttgggcatttgcaatg
attccagcaatcagaaaattatataagactaaagaagagagagctgcagcattagaacgt
cacttagagttctttaacactcacccatatgtagcttcaccagttgttggtgtaacatta
gctttagaagaagaacgtgcaaatggtgcaccaatcgacgatgtaactattcaaggtgtt
aagattggtatgatgggacctttagcaggtattggagatccagttttctggttcactgta
agaccaattttaggagcattagctgcttcacttgctctaggtggtaacatccttggacca
attatcttcttcttcgcttggaatatcatccgtatggcatttatgtggtatacacaagag
tttggttacaaagcaggatctcgtattagtgaagatttatcaggtaatatgctacaagat
attacaaaaggagcatctatccttggtatgttcatcttaggatcgttagttaacagatgg
gtatctgttaaatttgcaccagtagtatcatctgttaaattaagtgatggtgcatttatt
gattggagcaaacttcctgctggagcagaaggtgttaagcaagctctattacaacaagca
tcaggtatgtcattaactgatactaagattacaacattacaaaataacttagattcatta
atccctggatttgtaggattattaattacacttctttgtatgtggttacttaagaggaag
gtatctccaattcttataattcttggattgttcataattggtattgttttccacttgatc
ggtttaatgtag

DBGET integrated database retrieval system