KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0719Help
Entry
Cbei_0719         CDS       T00547                                 

Definition
(GenBank) Integrase, catalytic region
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve_2 rve HTH_21 rve_3 DDE_Tnp_IS240 Phage_CI_repr
Motif
Other DBs
NCBI-ProteinID: ABR32903
UniProt: A6LRC3
Position
complement(864784..865602)
Genome map
AA seq 272 aa AA seqDB search
MADLCNLAGIARSSYYKWINRSETELDKENSIILKEIVKLYEDVNGIYGYRRITMNINRL
LDKQYNHKRIYRLMKSINMRSVIRKKRKHYIQSTPQITAENKLNREFYAKKPNEKWLTAV
TEFKLLNGKKAYLSAIFDLADKSIVSYVVGHSNNNQLVFDTFDLAVSANPTAKPLFHSDR
GFQYTNRTFKAKLDKIKATQSMSRVSRCIDNGPMEGFWGTLKCEMYYLQKFYTYEELRQA
IDEYIVFYNTKRLQKNLKGLTPIEYRNQTLVS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctatgcaatttagctgggattgcacgatcatcttactacaaatggattaac
cgttcagagactgaattagataaggaaaattcaataatactaaaagagattgttaaactt
tatgaagatgtaaatggtatctatggataccgtcggataacaatgaatataaatagactc
ctggataaacagtataatcataaacgaatttatagattaatgaaatctattaacatgaga
tcagttataagaaaaaagagaaagcattatattcaaagtactccacaaattacagcagaa
aacaaattaaatagagaattttatgcaaagaaaccaaatgaaaaatggttaacagctgtt
actgaatttaaactacttaatggtaaaaaggcttaccttagcgcaatatttgatttagct
gataagagcattgtttcttatgttgttggtcactcaaataacaatcagcttgtttttgat
acatttgatttagcagtaagtgctaatccgactgcaaagccactgtttcatagtgacaga
ggatttcagtatactaataggactttcaaagctaaacttgataaaatcaaagcaactcaa
agcatgtcacgtgtcagcagatgtatcgacaacggaccaatggaaggtttttggggaact
ctaaaatgtgagatgtactatttgcaaaaattttatacatatgaagaattgagacaagca
attgatgaatacatagttttctataatacaaaaagactacagaaaaacttaaaaggtctg
actccaattgaatatcgaaatcagaccttggtttcataa

DBGET integrated database retrieval system