KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0721Help
Entry
Cbei_0721         CDS       T00547                                 

Definition
(GenBank) phage replisome organizer, putative
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_rep_org_N Glyco_transf_41
Motif
Other DBs
NCBI-ProteinID: ABR32905
UniProt: A6LRC5
Position
866577..867359
Genome map
AA seq 260 aa AA seqDB search
MKERRYVRFRVDMYEDTKFKIIDRMPERDVIYYIWTRIVILAGKVNLDGNLYMSKNIPYT
LKTLAIEFNRDESQVKLALDTFIDLEMVEVVEENVYKVKNFAKHQNIKVKVKDIDENKEK
MSKKDSKLKSEETKSVENIYDEKHDVEEEIGNEIIQKQKQKDNNMCNMENAIDTKNNIEI
KNAGISDNKNIISTVKINSGLKDNIPVPLVMNKNKKPKKDIRKNTDIEVTDEENDDEFGF
YEGDRKPLGKGESVFSDFSF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagagaagatatgtaagattcagagttgatatgtatgaggatacaaaatttaaa
ataattgatagaatgccagaaagagatgttatttattatatttggaccagaattgtaatt
ttagctgggaaagttaatctagatggcaacttatatatgtcaaaaaacattccatataca
ttaaagactttagctatagaatttaatagagatgaaagtcaagtaaaactggcattagat
acatttatagacttagaaatggttgaagttgttgaagaaaatgtttataaagtaaagaat
tttgcaaagcatcaaaatatcaaagtaaaggtaaaagatattgatgagaataaagaaaaa
atgagtaaaaaggatagtaagttaaaaagcgaagaaactaaaagtgttgaaaatatctat
gatgaaaaacatgatgttgaagaagagattggcaatgaaattattcaaaaacagaagcag
aaagacaacaatatgtgtaatatggagaatgcaattgatactaagaataatatagaaatt
aaaaatgcaggaatcagcgataataagaacataataagcacggtaaaaattaatagcgga
ctgaaagacaatatccctgtacctttagtaatgaataaaaataagaagccgaagaaagat
ataaggaaaaatacggatattgaggttaccgatgaggaaaatgatgatgaattcggtttt
tatgaaggagatagaaagcctttaggtaaaggcgaaagtgtatttagtgatttttctttt
tag

DBGET integrated database retrieval system