KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0722Help
Entry
Cbei_0722         CDS       T00547                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 POTRA_TamA_1 DUF5333
Motif
Other DBs
NCBI-ProteinID: ABR32906
UniProt: A6LRC6
Position
complement(867466..868338)
Genome map
AA seq 290 aa AA seqDB search
MESSELRIFRAVAQAGSITKAAQALGYVQSNVTARIQQLESDLNTQLFYRQRGMILTPTG
EKLLAYAEKIIYLLDEADKALNDCCDPSGSLSIGAVHTVSAIRLPEILSQYHKAYPKVDL
SLITSQSDELIYKIKHFQLDGAFVKAQSFSDENIVSELVVEETLVLISSPKYDNIEDLYS
KPFLMSTAGCPNRTQLENWLKSKSIHNIRYMEFNNLTSIIEGVIADLGASFVPKSTIEDY
EKKGLLKSFPVPDKYNTTKTFFIRRKDSLMTNSLSKFIEMTELNTPYKRT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtagtgaattaagaattttcagagctgttgctcaagcaggcagcataacaaag
gctgcgcaggctctgggatatgttcaatctaatgttacagctagaattcaacaattagaa
tccgatttaaatacacaactcttttatagacagcgaggtatgattttaactcctacaggt
gagaaattattagcttatgccgaaaaaatcatttatttattggatgaagctgataaagcc
ttaaatgattgttgcgatccttcaggaagtttatcaattggtgctgttcacacagtatct
gcaatacgtcttcctgaaatcttatctcagtatcataaagcttaccctaaagttgatcta
tctcttataacaagtcaatcagatgaacttatttataaaataaaacatttccagttagat
ggagcttttgtcaaagctcagtcctttagtgatgagaatatcgtaagtgaacttgtagtc
gaagaaaccttagtactaatatcaagtcctaaatatgataatatagaagatctatattca
aaaccatttttgatgagtacagcaggatgtcctaatagaacacaacttgaaaactggctc
aaatccaaaagcattcataatattcgatatatggaatttaataatttaacttctattatt
gaaggcgttattgctgatcttggtgcatcatttgtaccaaagtccactattgaagattat
gaaaagaaaggacttctaaaatcattcccagtgcccgataaatataatactacaaaaaca
ttttttataaggcgtaaagattctttaatgactaactcactttcaaaattcattgaaatg
accgagctaaatacaccatataaaagaacttaa

DBGET integrated database retrieval system