KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0730Help
Entry
Cbei_0730         CDS       T00547                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4317
Motif
Other DBs
NCBI-ProteinID: ABR32914
UniProt: A6LRD4
Position
complement(877468..878910)
Genome map
AA seq 480 aa AA seqDB search
MNKKDILELKRRLKKDDCTFTKMCGCYVDGQKDIVLKFKETFLNLREEEFFKYLEIAKKT
LSGTVGNNILELNFPLDEEGIGGRQLSLMELKKSKLKDDSMLDSFYKMIINSYEYTGNFL
ILVFHDAYDVMTKTTDNSKLDESEEVYEYILCAICPVSLSKPALGYLEDENRIGARIRDW
VVGPPDLGFVFPAFIDRSTDIHSIMYYTKDAKDPHPEFMEEALGCSSKQTATEQKETFQN
IIRKAAGSDDEKSEHLFMEIQETLNTIVDDHTTVNGKNAEPIVLSNDNIQDILIESGVPE
EITAKIEKSYTEAFGDTPPVAENLIDKKALAANEQRKKEEKLEKKVRILEERLEKTKLDA
LADSEKEAALESETESALNKILESEPNSALKTESDTILEVASDSNLDENLDSETASDANN
TENTEIETEISDAPNYDIVLNVKPQKVSQIKSQIIDGKKCIIIPIDDDEQAKVNGVNALL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaagatatattagaattaaaaagacgtttaaaaaaagatgactgtacattt
actaaaatgtgtggttgttatgtagatggtcaaaaagatattgtattaaaatttaaagaa
acttttttaaatctaagagaggaagaattctttaaatatttagaaattgccaagaaaaca
ctatctggaacagttggaaataacattcttgaacttaactttcctcttgatgaagaaggc
ataggtggcagacagctttccttaatggagctaaaaaaaagtaaattaaaagatgattct
atgctcgatagcttttataaaatgattataaatagttatgaatatactggtaactttcta
atactcgtttttcacgatgcctatgatgttatgacaaaaactacggataactcaaaatta
gatgaatctgaagaggtatatgaatatatattatgtgcaatctgtccagtatcactttca
aaaccagctcttggatatcttgaagatgaaaatcgaattggagctcgtattagagattgg
gtagttggtccaccagaccttggatttgtatttccagcatttatagatcgtagtactgat
attcattctattatgtattacacaaaagatgcaaaagatcctcatcccgaatttatggag
gaagctttaggttgtagttcaaaacaaacagctactgagcaaaaagaaacattccaaaat
ataattcgtaaagctgctggaagtgatgatgaaaaatcagagcatttatttatggaaatt
caagaaactctcaatactatagtagatgatcatactactgttaacggcaaaaatgctgag
cctatagttttgagtaatgataatattcaagatattttaatcgaaagtggagttcctgaa
gagatcactgcaaagattgaaaaatcatatacagaagcatttggagatactccgcctgta
gcagaaaatttaattgataaaaaagcacttgcagcaaatgaacaaagaaaaaaggaagaa
aaacttgaaaagaaagtacgcatattagaagaaagacttgaaaagacaaaactggatgct
ttagcagattcagagaaagaagctgctttagaatcagaaactgaatcagctttgaataag
atcttagagtcagagcctaattctgctttaaagacagaatctgataccatcttagaagtg
gcttctgactctaatttagatgaaaatcttgattcagaaacagcatctgatgcaaataat
actgaaaacactgaaatagaaactgagattagcgatgctccaaattatgatattgtactt
aatgtaaaacctcaaaaagtatctcaaataaaatcacaaataatagacggaaagaaatgt
attataattcctatagatgatgatgaacaagctaaagtaaatggcgttaatgctttgctt
taa

DBGET integrated database retrieval system