KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0733Help
Entry
Cbei_0733         CDS       T00547                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K10118  raffinose/stachyose/melibiose transport system permease protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe02010  ABC transporters
Module
cbe_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cbei_0733
Transporters [BR:cbe02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    Cbei_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABR32917
UniProt: A6LRD7
Position
882191..883054
Genome map
AA seq 287 aa AA seqDB search
MKKKKAFYIMTIPAVLLFFIFHTLSLLEGVFYSFTNSKGYGDWSFVGLKNYIAVFQDSNV
MHAYIFTFKFAIITTIIVNILSLLIAVGLNSKIKFQNTLKSIYFIPNILGTLIVAFIFNF
VFAHVIPNIGETMNISMLSKNILGDEKLAWLGIVFVAAWQSIAFNTIIYLSGLQTIDTDV
YEACDIDGAGSWQRFKSITFPLIAPFFTINMVLCMKGFLMVFDQVVAMTGGGPGTVTQSI
SYVIYNGGFNQGSFAYQSANAVIYFIVIVAISLFQLRVLEKREEKVL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagaaaaaagctttttatattatgactataccagcagttttgttattctttata
tttcatacattatctcttttagaaggtgtattttatagttttaccaattcaaaaggatat
ggtgattggagttttgttggattaaaaaactatattgcagtgtttcaagatagtaatgtt
atgcatgcgtacatttttactttcaaatttgcaattataactacaattatagtaaacata
ttaagtcttttaattgctgtaggcttaaactcaaaaatcaaatttcaaaataccttaaag
tcaatatattttattcctaatatattaggaactttaatagtggcatttatattcaatttt
gtatttgctcatgttataccaaacattggagagactatgaacatttctatgcttagtaaa
aacatattaggtgatgaaaagcttgcatggcttggaatagtgtttgtagcagcatggcaa
tcaatagcctttaatacaataatatatttatctggacttcagacaattgatactgatgtt
tacgaagcctgtgatattgatggtgctggttcatggcaaagatttaaaagcataacattt
ccattaatagcaccatttttcacaattaacatggttttatgtatgaaaggatttttaatg
gtatttgatcaggttgtagctatgacaggaggaggacctggaactgttactcaatcaata
tcttatgtaatttataacggaggatttaaccaaggaagttttgcatatcaatctgcaaat
gctgttatttacttcatcgtaattgtagcaatatcattatttcagcttagagtccttgaa
aagagggaggaaaaagtactatga

DBGET integrated database retrieval system