KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0735Help
Entry
Cbei_0735         CDS       T00547                                 

Definition
(GenBank) alpha amylase, catalytic region
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00052  Galactose metabolism
cbe00500  Starch and sucrose metabolism
cbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Cbei_0735
   00500 Starch and sucrose metabolism
    Cbei_0735
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     Cbei_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABR32919
UniProt: A6LRD9
Position
883929..885569
Genome map
AA seq 546 aa AA seqDB search
MDKKWWKESVVYQVYPRSFNDSNGDGIGDLRGIIEKLDYLKELGIDVIWLSPVYKSPNDD
NGYDISDYEDIMDEFGTMEDMDDLIEEGNKRGIKILMDLVVNHTSDEHKWFIEAKKSKDN
PYRDYYIWRDPVNGEEPNDLRSTFSGSAWQYDETTGQYYLHLFSKKQPDLNWENEEVRNR
IYKMMNFWIDKGIGGFRMDVIELIGKIPDKKVTHNGPKLHEYIREMNKKTFGGKDLLTVG
ETWGCTTEIAKKYSNPDDSELSMIFQFEHILLDQQPGKEKWDLKPLELLDLKKALSRWQV
ELEGTGWNSLFWNNHDVPRIVSRWGNDKEYRVESAKMLATLLHGMKGTPYIYQGEELGMT
NVRFESLEDYKDIETLNMYNERKKQGYTHEEIMLSIYTKGRDNARTPMQWNDSQNAGFTS
GQSWLKVNPNYKEINAESQLKDENSIFNYYKKLIKIRKSNPVVVYGKYELMLEENKEIFA
YTRTLENEMLLVICNFTGNETEFVLERKFEFKSKELLISNYNVNENDSIESIELKPYESR
IYKFIL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatggtggaaagaaagcgttgtttatcaggtatatcctaggagttttaat
gattctaatggagatggaattggagatttaagaggaataatagagaagttagattacttg
aaagaattggggatagatgtaatatggttatctccagtatataaatcaccaaacgatgat
aatggatatgatataagcgattatgaagatataatggatgaatttggaacaatggaagat
atggatgatcttattgaggaaggaaataaaagaggaataaaaattcttatggatttagtt
gtaaaccatacttctgacgaacataaatggttcatcgaagctaagaaatcaaaagataat
ccttatagagattattatatatggagagatccagtaaatggagaagaaccaaatgattta
agatcaacatttagcggtagtgcatggcaatatgatgaaactacagggcagtattattta
catttatttagtaaaaaacagccagatttgaactgggaaaatgaagaggtgcgcaataga
atttataaaatgatgaatttttggattgataaaggtattggcggatttagaatggatgta
attgaacttataggaaagattccagataaaaaagttacgcataatggtccaaaactccat
gaatatattagagaaatgaataagaagacattcggaggcaaagatttactaacagttgga
gagacttggggatgtactacagaaatagctaagaaatattcaaatccagatgatagtgaa
cttagcatgatatttcaatttgagcacattttattagatcaacaaccaggtaaagaaaaa
tgggatttaaagccgttagaattattagatttaaagaaggcattatctagatggcaagta
gagctagaaggcacaggttggaatagtttattctggaataatcatgacgtaccaagaata
gtttcaaggtggggaaatgataaagaatatagggtagaaagtgcgaaaatgcttgctaca
ttattacatggaatgaaggggactccatatatatatcaaggtgaagagcttggtatgaca
aatgtaagatttgaatcattagaggattataaggatatagaaactctaaacatgtataat
gaaagaaaaaaacaaggttatactcatgaggagataatgttatctatatatacaaaaggc
agagataatgcgcgtaccccaatgcaatggaatgatagtcaaaatgcaggctttacaagt
ggacagtcttggctaaaagtaaatcctaattacaaagaaataaatgctgagtctcaatta
aaagatgaaaactctatattcaattattataaaaaactaataaaaataagaaaatccaat
ccagtagttgtatacggaaaatatgaattgatgttagaagaaaacaaagaaatatttgca
tatacaagaactttagaaaatgaaatgttactagttatatgtaactttacaggaaatgag
acagagtttgtacttgaaagaaaatttgaatttaaatctaaagaacttttaatttcaaat
tataatgttaatgaaaatgattcgattgagagtatagaacttaagccatatgaatctaga
atttataagtttatattatag

DBGET integrated database retrieval system