KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0742Help
Entry
Cbei_0742         CDS       T00547                                 

Definition
(GenBank) membrane protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GAPT HemX CBM49
Motif
Other DBs
NCBI-ProteinID: ABR32926
UniProt: A6LRE6
Position
893159..894373
Genome map
AA seq 404 aa AA seqDB search
MISVIETAIITIIISFISGLLLEYYKNLAPKILCNIGEGVPLELNNKKICAYVLTVRNIS
NKTIHKLTLNIQGLQNDLKIGDAQITKGLKFDSSIEDNILDVYIPFLSKDDEFSATLYVE
SKYGEYKKPVVTIRSPENFKEIQSIEQGGIISSLLNMPKNIKNLICNITKDDKASTSNRG
RRSTVNKGQTAKKIGGKENSTRFGRDKNSYNNRKALIAIISLILIISIGGLGALYFQEMS
TNAKTSDEKTEVQKQSTSESQSEGEQTKNANEKIPTSGKNKNSPVKVSGNEANKDSGAKT
SQNGDTGTPDTKTQAGGASGNSDIKTSTDANSPNNTDTKAPTIGGTNGSTNLKSPSGTSS
ENTDAKASTSGTNGNTDQKTSTDGTTKNVDTKSSTGGTTANSGN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgataagtgttatcgaaactgcaattataactataataatatcatttatatctggatta
ctgttagagtattataaaaatctggctcctaaaatattatgcaatataggagaaggtgta
ccactagaattaaacaacaaaaaaatatgtgcatatgttcttacggtaagaaacatatca
aataaaacaattcataagttaaccttaaatatacaagggttacaaaatgatttgaaaatt
ggagatgctcaaataacgaaaggtttgaaatttgattcttcaatagaagataacatttta
gatgtatatatacctttcttaagtaaagatgatgaattttcagctacattgtatgtggaa
agtaagtatggagaatataaaaagcctgttgtaacaattagatcacctgaaaattttaaa
gagatacaatcaattgagcaaggaggaataatatcctcattacttaacatgcctaaaaat
ataaagaatttaatttgtaatataacgaaggatgataaagcttcaacttctaatagaggg
cgcagatctacagtaaataaaggacaaactgctaagaaaataggtggtaaagaaaatagt
acgagatttggtagagataaaaactcatataacaatagaaaggcgctaatagccattata
tcgctcattttgattataagcattggaggattaggcgcattatattttcaggagatgtcc
actaatgcaaaaacttcagatgaaaaaactgaagttcagaagcaatcaacgagtgaatcg
cagtcagaaggtgaacagactaagaatgcgaatgaaaaaataccgacaagtggaaaaaat
aaaaattctccagtaaaagtttcaggtaatgaagcaaataaagattcaggcgcaaaaaca
tcacaaaatggagatactggaacaccagatacaaagacacaagcaggtggagcatcggga
aattcagatataaaaacatcaacagatgcaaatagcccaaataatacagatacaaaagca
ccaacaattggtggaacaaatggaagcacaaacttaaagtcgccatcaggaacatcaagt
gaaaatacggatgcaaaggcatcaacaagtggaacaaatgggaatacagatcagaaaact
tctacagatggaactactaaaaatgtggatacaaagtcatcgacaggtgggacaactgcg
aattcaggaaattaa

DBGET integrated database retrieval system