KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0743Help
Entry
Cbei_0743         CDS       T00547                                 

Definition
(GenBank) FliB family protein
  KO
K18475  lysine-N-methylase [EC:2.1.1.-]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Brite
Enzymes [BR:cbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Cbei_0743
Bacterial motility proteins [BR:cbe02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    Cbei_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BRCA-2_OB3 CxxCxxCC
Motif
Other DBs
NCBI-ProteinID: ABR32927
UniProt: A6LRE7
Position
894664..895797
Genome map
AA seq 377 aa AA seqDB search
MNKIDTLKISNYDKFKCTADKCKFTCCEGWDISVDDNTYDNWKNDKSNNILNNVKIKRYE
GKDEYFINKKTNEVCPLLDSHGLCNIVKDHGENYLSLTCQMFPRIENIFEDRRELSLSCS
CPEVLEFIGSETGKINMTSESHIYLESNALEIKVRETIINIMQQEKFLLEDKLIISFQML
STILENDDLGEDALLKELEKYKDRNYVKELIDMYKGIKINTNDSVEEVNNLFLDIIENYK
EVSIFNILLKDIANFAENAKIKKLSSKWNDYKSLFEQYNDFVENCIISKIFSNCISDDIE
EMIISFQMIILEYLLLRYSLFLKYCMENKIDEEDIKNYTVAFSRIIGNNTDAMIEFIRDG
FEDDILEIGYLCFITLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatagataccttaaaaatttcaaactatgataagtttaagtgcacagctgat
aagtgtaaattcacatgttgtgaaggatgggatattagtgtagatgacaatacatatgat
aattggaaaaatgacaaatctaataatattttaaataatgtaaaaataaaaagatatgaa
ggtaaagatgagtattttataaataagaaaacaaatgaagtatgtccgcttttagacagc
catggattatgcaatatagtaaaagatcatggggaaaattatttatctttaacatgccaa
atgtttcctagaatagagaatatttttgaggatagaagagagctttcattatcatgttcc
tgtccagaagtattagagtttataggtagtgagactggcaaaataaatatgacttcagaa
agtcatatttatttagaaagtaatgcgttagaaattaaagttagagaaaccatcataaac
ataatgcagcaagaaaaatttttactagaagataaacttattattagctttcaaatgcta
tcgactattttagaaaatgacgatcttggagaagatgccttattaaaggaattggaaaag
tataaggataggaattatgtaaaagagcttattgacatgtataagggaataaagataaat
acaaatgactcagttgaggaagtcaataatctatttttagatatcatagagaattataag
gaagtttctatttttaatattcttttaaaagatattgctaatttcgcggaaaatgctaaa
attaaaaaactttcatctaaatggaatgattataaaagtttgttcgagcaatataacgac
tttgttgaaaattgcattatatctaaaatttttagcaattgtatcagtgatgatatagaa
gagatgattatttcattccaaatgattatattagagtatttattgttaaggtattcctta
ttcttaaaatattgcatggaaaataaaatagatgaggaagacataaagaattacactgta
gctttttcaagaataataggtaataatactgatgctatgatagaattcattagggatggt
tttgaagatgatattttagagattggatatttgtgttttataactttagtttaa

DBGET integrated database retrieval system