KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0745Help
Entry
Cbei_0745         CDS       T00547                                 

Definition
(GenBank) hypothetical protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2
Motif
Other DBs
NCBI-ProteinID: ABR32929
UniProt: A6LRE9
Position
898983..900563
Genome map
AA seq 526 aa AA seqDB search
MSALIKKIIYLIFTFFIGLFIASSFFVRAKYNTFLYGDKPVLQNQKLGIFIFMILILVLL
SVDLYRMCLKLNRYSKKIVIPVTLVFSFIIQMIIIFLFTKLPTADSQTVLSLALNMLYRN
DYSSFQSSGYLYMFPFNFSTVLYLKTLLTIFPNNYLVLKIFNILFTLVTSLIIYYIYKEI
NYKSRDNDYGVLIFASTYIPSLFMSNYIYNDIIATTLLTSSIYFLIRFVKDGSIKYIVIA
SVCLSIGNYFRSVGTIVLIAAVFYILLQVKKTGVKKAITSFCILGVLFNIPNWNQNFILQ
ETNIVNESVNKNSAPIYMWINMGMNEDTIGYWDNMKSYNIYQRQARYNKEKSTELFKEEI
KNKLSNMGFTSLSKMYYDKIIWTWTEGTYQIETFGIGNEAVSSSQRVGREEKVYSYNTFA
TELFKGDSVYRSGLLWILYVMNFLMYCFIFIRMIGVIKEKKFDEVLLVLVFLGFIGFYVL
WEIKSRYIYPTYPILIILSYMGFKDVYEFVSRRSFIKYMLSIRKGL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgttaattaaaaagataatatatttaatatttactttttttataggacttttt
atagcatcatcattttttgttagggcaaagtataatacttttttatatggagataagcca
gttcttcaaaatcaaaaacttggtatttttatattcatgatattaattttagttttatta
agtgtagatttatatagaatgtgcttaaaacttaacagatatagcaagaaaatagtaatt
ccagtaactttggtatttagttttattattcaaatgataattatatttttatttactaaa
ttaccgacagctgattctcaaacagtactatcattagctttaaatatgttgtataggaat
gattattcgtcatttcaaagtagcggatatttatatatgtttccttttaatttttcaact
gtattgtatttgaaaactttattaactatatttcccaataactatttagttcttaaaatt
ttcaacattttatttaccctagttacgagtctaatcatttattacatatataaagagata
aattataaatcaagagataatgattatggagttttgatatttgcatcaacctatatacca
tctttatttatgagtaattatatatataacgatattatagctacaacattgcttacaagc
tctatatattttttgataagatttgtgaaggatggatcaattaaatatattgtaattgct
tcagtgtgtttatcaataggaaattattttagaagcgtaggaactattgttttaatagct
gctgttttttatattttactgcaagtaaagaagactggagttaaaaaggcaataacatca
ttctgcatattaggagtgctatttaatattcccaattggaatcaaaatttcattttgcag
gaaacaaatattgtgaatgaatctgttaataaaaattctgcacccatatatatgtggatt
aatatggggatgaatgaagatacgataggttattgggataatatgaaaagttacaatata
tatcaaagacaggcaagatataataaagaaaaaagtacagagttatttaaagaagaaatt
aaaaataaattatcaaatatgggtttcactagtttatcaaaaatgtattatgacaagatt
atatggacttggacagaagggacataccaaattgaaacctttggcattggtaatgaagca
gttagctcatctcagagagttggaagagaagaaaaagtatatagctataatacttttgcg
actgaactatttaaaggagattcggtctatagaagtggattactttggattttgtacgta
atgaattttcttatgtattgttttatattcataagaatgataggtgtaataaaggaaaag
aaatttgacgaagtgctcttagttttagtgtttttaggatttattggattttatgtttta
tgggaaataaaatctagatacatttatccaacataccctatattaataattttatcatac
atgggatttaaagatgtgtatgaatttgtttcaagaagaagttttattaaatatatgtta
tcaattagaaaggggttgtag

DBGET integrated database retrieval system