KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0747Help
Entry
Cbei_0747         CDS       T00547                                 

Definition
(GenBank) glycosyl hydrolase, BNR repeat-containing protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABR32931
UniProt: A6LRF1
Position
902709..904403
Genome map
AA seq 564 aa AA seqDB search
MKKYRQIIKRSIFLSMISNPIFVFIYCISIYELYTLSRFGRFHNNIIILFGCIIFLLVWL
TYVIIKSVKKPISVPQQIIEKYKFNESNIKVLQEDELEIDFQDIKSFRINRKYAVITLRN
RDILVLSMIDRTDEEIVIIKKSLNDGKIFKSNYKTIWIYIAMIVIAATTLFYGAKIYNDT
ISYNGKLSWFLSDLKNKKTVKLEHNNIYENGIEGIFADINKEIHMPDKLYVSSNFNLNFN
SDGAITSFDTYLYGKDNKGKLESYLISYNNDKSDKITIYLNGYANADYNEDKLLEPLLST
MKAIPLKDTVSKWNENKYGILYYGNRSFGYNTDGITYINPEGSTKAASKASSEIIGYAVS
VFVPGKEKIYTPYRYILTEDLNNIKTHTPLKEDKDKSISQKSNNQDEFYMSDQVGYRLEV
TGAAAGSRSYSLKSTINGGNTWTIVNEDPFAGKTGVAAGISFLNDKLGFLCLSHSGGSNG
ELYRTEDGGVSYKKVSFPERKVTLDNGEKYNPFDLPDMPYEQDGILNVLIGQGSDGDYNG
GCKALYESKDEGLTWQYVKEVDNK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacaggcaaattataaaaagaagtatatttttatcaatgatatctaaccca
atatttgtatttatatattgtatttcgatttatgagctatatacgctttctaggtttgga
agatttcataataatattattatattgtttgggtgtataatattccttttagtgtggctt
acatatgtaataataaaaagtgtaaaaaagcctataagtgttccgcaacagattatagaa
aaatataaatttaatgaaagcaatataaaagttttacaagaagacgaactagagatagat
tttcaagatataaagtcatttagaataaataggaaatatgctgttataacacttagaaac
agagacatattagttttaagtatgatagatagaacagatgaagaaatagtcataataaag
aagagcttgaatgatggaaagatttttaaatcaaattataaaactatatggatctatata
gctatgatagttatagctgctacaacattattttacggagcaaaaatatataatgataca
ataagctataacggaaaactttcgtggtttttaagtgatttaaaaaacaaaaagacagtg
aagcttgaacataacaatatatatgaaaatggaatagaaggtattttcgcagacattaat
aaagaaattcatatgccagataaattgtatgtttcaagtaactttaatcttaattttaat
tccgatggagcaattacgtcttttgatacatatctttatggaaaagataataagggtaag
ttagaaagttatttaataagttataataatgacaaatcagataaaataacaatatattta
aatgggtatgcaaatgctgattataatgaagataaattgttagagccattgctaagtaca
atgaaagctatcccacttaaggatacagtgagcaaatggaatgaaaataaatatgggatt
ctttattacggtaaccgaagttttggatataatactgatggaattacttatattaatcca
gaagggagcacaaaagcagcttcaaaggcctcttcagagataataggttatgctgtttca
gtattcgtacctggtaaagaaaaaatatatactccgtatagatatattttaacagaagat
ttaaataacattaagacgcatacacctttaaaagaagacaaagataaaagtatttctcaa
aaatcaaataatcaggatgaattttatatgtctgatcaagttggttataggctagaagtg
actggagctgcagctggaagcagatcgtactctttgaagagcacaattaatggtggaaat
acatggacaattgtaaatgaagatccttttgcagggaaaacaggggtggcagctggaata
agttttttgaatgataaacttggttttttatgtttatctcatagtggtggcagtaacgga
gaattatatcgcaccgaggatggcggtgtatcttataaaaaagtaagttttccagagaga
aaagtaacactagataatggggaaaaatataatccttttgatttgccagatatgccttat
gagcaagacggaatccttaatgttttaataggtcaaggatctgatggagattataatggg
ggatgcaaggctttgtatgaatcaaaagatgaagggttaacatggcaatatgtaaaagaa
gttgataataagtga

DBGET integrated database retrieval system