KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0749Help
Entry
Cbei_0749         CDS       T00547                                 

Definition
(GenBank) transcriptional regulator, RpiR family
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_6 SIS SIS_2 HTH_AsnC-type HTH_Tnp_ISL3 HTH_24 HTH_IclR HTH_29
Motif
Other DBs
NCBI-ProteinID: ABR32933
UniProt: A6LRF3
Position
905613..906497
Genome map
AA seq 294 aa AA seqDB search
MNHTESYEYKIKNMYNLLRSSEKKVADYVLLNGHSVSTMTLAELSRQVGVSEPTIIRFVK
SIGCSGYSEFKMALMKEWGRESVDKQYDSKLLVELHIDRDEKIEDVPVKMIGLTIKALED
TLKIIDINKYKKAIEMIRSSNIIDVYGVGNSGSVASDIRNKFLRIGLECRAYSDSNIQQI
CASHLTSNDLAIGVSHSGSTIDTVNALKIAKESGARTIALTNFKAPAISEYADITFFTGG
EETTFYSETMVSRISQLAIVDMLYMGILLDDYDLYTKRLEKINLLLKEKNYTKK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccatactgagtcttacgaatataaaataaaaaatatgtataatttactgagatca
tctgaaaaaaaagtagccgattatgtattattaaacgggcattctgtttctacaatgact
ttagcagagctttctcgtcaagtaggggtgagtgagccaacaattatacgttttgtgaaa
agtataggttgtagtggatatagtgaatttaagatggcattaatgaaagagtggggaagg
gaatctgtagataagcagtatgattccaaattactagtagaacttcatattgatagagat
gaaaaaatagaagatgtgccagtaaaaatgattggacttactataaaggctttggaagat
actttaaaaataattgatattaataaatataaaaaggcaatagaaatgattagaagctca
aatatcattgatgtttacggtgtggggaattcgggaagtgttgctagtgatattagaaat
aaatttttacgtataggattagaatgcagagcatactctgatagtaatatacagcaaatc
tgtgcaagtcatctaacaagtaatgaccttgccattggtgtatcccattcaggaagcaca
atagatactgtaaatgctttaaaaatagcaaaagagtctggagcaagaactattgcatta
acaaattttaaagcaccagctatttctgaatatgcagacataacattttttactggtggt
gaagaaactacattttatagtgagacaatggtttcacgcatatcgcagttagctattgtg
gatatgctttatatgggaattttgctagatgattatgatttatatactaaacgccttgaa
aaaattaatcttttacttaaagaaaagaattatacaaagaaatag

DBGET integrated database retrieval system