KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0750Help
Entry
Cbei_0750         CDS       T00547                                 

Definition
(GenBank) GreA/GreB family elongation factor
  KO
K03624  transcription elongation factor GreA
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cbe03021]
    Cbei_0750
Transcription machinery [BR:cbe03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     Cbei_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GreA_GreB_N GreA_GreB
Motif
Other DBs
NCBI-ProteinID: ABR32934
UniProt: A6LRF4
Position
complement(906685..907149)
Genome map
AA seq 154 aa AA seqDB search
MNNILTEENIKKLREELDYRMTVKRAEIAKEKLVAAAHGDRSENAEYKEACRNYRENDNR
IQYLLTMISTATVIDDGSIDKSVLGINSKARIRFVEDDDEVVVTLVTTMDLDPENMIISI
ESDLGKALSGNKAGDIVEVNAPGEKYSVEILEVL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaataatattctaactgaagaaaatataaaaaagttaagagaagaattagattatagg
atgacagttaaaagagctgaaatagcaaaagaaaaattagtagctgctgctcacggagat
agatcggaaaatgctgaatataaagaggcttgcagaaactatagagaaaatgataataga
atccagtatctattaactatgatttcaactgcaacggtaatagatgatggtagtatagat
aaatcagtactaggaattaatagcaaagctagaattaggtttgtcgaagatgatgatgag
gttgttgtaacactagtaacaactatggatctcgatcctgaaaatatgattataagtatt
gaatcagacttaggtaaagcattatctggaaataaagctggtgacattgttgaagtcaat
gctccaggtgaaaaatattcagttgaaatactcgaagtactataa

DBGET integrated database retrieval system